DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and MMP26

DIOPT Version :9

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_068573.2 Gene:MMP26 / 56547 HGNCID:14249 Length:261 Species:Homo sapiens


Alignment Length:284 Identity:94/284 - (33%)
Similarity:128/284 - (45%) Gaps:53/284 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LPPEGSHSTAATRSKKAKTAISEDIMYNYLMQFDYLPKSDLETGALRTEDQLKEAIRSLQSFGNI 89
            :||...|.             ..|.:..|..|| :|.|.:.......|:.||      ||.| :.
Human    20 VPPAADHK-------------GWDFVEGYFHQF-FLTKKESPLLTQETQTQL------LQQF-HR 63

  Fly    90 TVTGEIDSATARLIQKPRCGVGDRRSADSFSPDNLYHEIGSNVRVRRFALQGPKWSRTDLTWSMV 154
            ..|..:|.....|:.:|.|||.| .|..|.||...                  ||::..||:.::
Human    64 NGTDLLDMQMHALLHQPHCGVPD-GSDTSISPGRC------------------KWNKHTLTYRII 109

  Fly   155 NRSMP---DASKVERMVQTALDVWANHSKLTFREVYSDQADIQILFARRAHGDGYKFDGPGQVLA 216
            |  .|   ..|.|:..:..|:.:|:|.:.|.|::|.:..|||::.|.:.||.||:.|||||.:|.
Human   110 N--YPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILG 172

  Fly   217 HAFYPGEGRGGDAHFDADETWNFDGESDDSHGTNFLNVALHELGHSLGLAHSAIPDAVMFP--WY 279
            |||.|..|..|..|||.:|.|     |....|.|...||.||:||||||.||....::|:|  ||
Human   173 HAFLPNSGNPGVVHFDKNEHW-----SASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWY 232

  Fly   280 QNNEVAGNLPDDDRYGIQQLYGTK 303
            .:.... .|..||...||.|||.|
Human   233 HDPRTF-QLSADDIQRIQHLYGEK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 Peptidase_M10 143..301 CDD:278824 64/162 (40%)
ZnMc_MMP 143..301 CDD:239805 64/162 (40%)
HX 513..707 CDD:238046
MMP26NP_068573.2 Cysteine switch. /evidence=ECO:0000250 80..87 5/7 (71%)
Peptidase_M10 98..253 CDD:306839 64/162 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10201
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.