DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and mmp16a

DIOPT Version :9

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:XP_021326042.1 Gene:mmp16a / 564419 ZFINID:ZDB-GENE-070820-1 Length:344 Species:Danio rerio


Alignment Length:242 Identity:76/242 - (31%)
Similarity:122/242 - (50%) Gaps:26/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 PRPTNKPYPTVHRQHHH-------------------HNKPRKP--KPDSCMTYYDAISIIRGELF 531
            |:|| :|.|||.....|                   .:||..|  |||.|...::.::|:|.|:|
Zfish    34 PQPT-RPSPTVPPARSHPPVDPRKNDRQTRPPRIPTGDKPTHPNAKPDICDGGFNTLAILRREMF 97

  Fly   532 IFRGPYLWRIGTSGLYNGYPTEIRRHWSALPENLTKVDAVYENKQRQIVFFIGREYYVFNSVMLA 596
            :|:..:.||:..:.:..|||..|...|..||   .|:||||||.:.:.|||.|::::||...||.
Zfish    98 VFKDHWFWRVRDNAVMPGYPMLINVFWRGLP---PKIDAVYENSKGKFVFFKGKQFWVFKDTMLL 159

  Fly   597 PGFPKPLASLGLPPTLTHIDASFVWGHNNRTYMTSGTLYWRIDDYTGQVELDYPRDMSIWSGVGY 661
            ||:|:.:...|.......|:.:..|....:||...|..|||.::....::..||:.:::|.||..
Zfish   160 PGYPQDITMFGNGMPAQSIEMAVWWEDVAKTYFFKGDRYWRYNEDMRTMDPGYPKSITVWKGVPD 224

  Fly   662 NIDAAF-QYLDGKTYFFKNLGYWEFNDDRMKVAHARAKLSARRWMQC 707
            :...|| ...:|.|||:|...||:||:.|::|.....:...:.:|.|
Zfish   225 SPQGAFVDKANGFTYFYKGKEYWKFNNHRLRVEPGYPRSILKDFMGC 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 Peptidase_M10 143..301 CDD:278824
ZnMc_MMP 143..301 CDD:239805
HX 513..707 CDD:238046 63/194 (32%)
mmp16aXP_021326042.1 Peptidase_M10 <1..28 CDD:332519
HX 79..271 CDD:238046 63/194 (32%)
DUF3377 284..344 CDD:314687
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.