DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and vtna

DIOPT Version :9

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001018508.1 Gene:vtna / 553699 ZFINID:ZDB-GENE-050522-440 Length:514 Species:Danio rerio


Alignment Length:269 Identity:64/269 - (23%)
Similarity:94/269 - (34%) Gaps:87/269 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   476 AREPVTPTANTTPRPTNK-------------PYPTVHRQHHHHNKPRKPKPDSCM-TYYDA-ISI 525
            |.|| ||...|...||||             |.||         |.:.|..:.|. ..:|| :.:
Zfish   110 ANEP-TPVIATAATPTNKNPATTPGATTTAQPTPT---------KAKDPDAEVCSGRPFDAFMQL 164

  Fly   526 IRGELFIFRGPYLWRIGTSGLYNGYPTEIRRHWSALPENLTKVDAVYENKQRQIVFFIGREYYVF 590
            ..|.::.|||.|.:.:....:..|||..|...|                                
Zfish   165 KNGSIYAFRGEYFFELDEKSVLPGYPKLIEDIW-------------------------------- 197

  Fly   591 NSVMLAPGFPKPLASLGLPPTLTHIDASFV-WGHNNRTYMTSGTLYWRIDDYTGQVELDYPRDMS 654
                   |...|            |||:|. .....:||:..|..|||.||  |.::.|:|||::
Zfish   198 -------GIKGP------------IDAAFTRINCQGKTYIFKGNKYWRFDD--GVLDDDFPRDIA 241

  Fly   655 I-WSGVGYNIDAAF------QYLDGKTYFFKNLGYWEFNDDRMKVAHARAKLSARRWMQCARSAN 712
            : :..:..::||||      .:...|.||||...|:.:............|:|.|......|...
Zfish   242 VGFEKIPDHLDAAFATPAHSHHGKEKVYFFKGDQYYHYEFKHQPSHEECIKMSLRSPSMLFRRYT 306

  Fly   713 EVDDEQRWT 721
            ::..: |||
Zfish   307 DIYYD-RWT 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 Peptidase_M10 143..301 CDD:278824
ZnMc_MMP 143..301 CDD:239805
HX 513..707 CDD:238046 45/203 (22%)
vtnaNP_001018508.1 Somatomedin_B 19..56 CDD:279385
HX 151..>299 CDD:238046 45/200 (23%)
HX <469..504 CDD:214524
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.