DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and MMP7

DIOPT Version :9

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_002414.1 Gene:MMP7 / 4316 HGNCID:7174 Length:267 Species:Homo sapiens


Alignment Length:303 Identity:118/303 - (38%)
Similarity:163/303 - (53%) Gaps:47/303 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLALFAQSMCIQELSLP-PEGSHSTAATRSKKAKTAISEDIMYNYLMQFDYLPKSDLETGALRTE 73
            |..|.|..:....|:|| |:.:...:..:.::|:         :||.:| ||  .|.||   :..
Human     3 LTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQ---------DYLKRF-YL--YDSET---KNA 52

  Fly    74 DQLKEAIRSLQSFGNITVTGEIDSATARLIQKPRCGVGDRRSADSFSPDNLYHEIGSNVRVRRFA 138
            :.|:..::.:|.|..:.:||.::|....::|||||||.|                     |..::
Human    53 NSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPD---------------------VAEYS 96

  Fly   139 L--QGPKWSRTDLTWSMVN--RSMPDASKVERMVQTALDVWANHSKLTFREVYSDQADIQILFAR 199
            |  ..|||:...:|:.:|:  |.:|..: |:|:|..||::|.....|.||:|....|||.|.|||
Human    97 LFPNSPKWTSKVVTYRIVSYTRDLPHIT-VDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFAR 160

  Fly   200 RAHGDGYKFDGPGQVLAHAFYPGEGRGGDAHFDADETWNFDGESDDSHGTNFLNVALHELGHSLG 264
            .||||.|.|||||..|||||.||.|.|||||||.||.|. ||   .|.|.|||..|.||||||||
Human   161 GAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWT-DG---SSLGINFLYAATHELGHSLG 221

  Fly   265 LAHSAIPDAVMFPWYQNNEVAG-NLPDDDRYGIQQLYGTKEKT 306
            :.||:.|:|||:|.|.|.:... .|..||..|||:|||.:..:
Human   222 MGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 Peptidase_M10 143..301 CDD:278824 83/160 (52%)
ZnMc_MMP 143..301 CDD:239805 83/160 (52%)
HX 513..707 CDD:238046
MMP7NP_002414.1 PG_binding_1 31..82 CDD:396175 15/65 (23%)
Cysteine switch. /evidence=ECO:0000250 85..92 6/27 (22%)
Peptidase_M10 103..259 CDD:395334 83/160 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 153 1.000 Domainoid score I4299
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10201
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X44
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.