DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and vtnb

DIOPT Version :9

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001132933.1 Gene:vtnb / 403026 ZFINID:ZDB-GENE-041116-1 Length:449 Species:Danio rerio


Alignment Length:228 Identity:56/228 - (24%)
Similarity:79/228 - (34%) Gaps:87/228 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   480 VTPTANTT-------PRPTNKPY--PTVHRQHHHHNKPRKPKPD----SCMTYYDAISIIRGELF 531
            |.||..|.       |..|..||  ||.           .|.||    |..|:...:.:..|.:|
Zfish    76 VMPTEETNLTVTTALPTTTAAPYVSPTA-----------PPDPDAVTCSRRTFDAFMQLKNGSIF 129

  Fly   532 IFRGPYLWRIGTSGLYNGYPTEIRRHWSALPENLTKVDAVYENKQRQIVFFIGREYYVFNSVMLA 596
            .|||.|.:.:....:..|||..|:..|                                      
Zfish   130 AFRGDYFFELDDRSVMPGYPKLIKDVW-------------------------------------- 156

  Fly   597 PGFPKPLASLGLPPTLTHIDASFV-WGHNNRTYMTSGTLYWRIDDYTGQV-ELDYPRDMSI-WSG 658
             |...|            |||:|. .....:||:..|..|||.|   |.| :.|||||::: :..
Zfish   157 -GINGP------------IDAAFTRINCQGKTYIFKGNKYWRFD---GDVLDEDYPRDIAVGFEK 205

  Fly   659 VGYNIDAAF------QYLDGKTYFFKNLGYWEF 685
            :..::||||      .:...|.||||...|:::
Zfish   206 IPDDVDAAFAIPAPGHHGREKVYFFKGDQYYQY 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 Peptidase_M10 143..301 CDD:278824
ZnMc_MMP 143..301 CDD:239805
HX 513..707 CDD:238046 45/186 (24%)
vtnbNP_001132933.1 Somatomedin_B 19..56 CDD:279385
HX 112..440 CDD:238046 43/181 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.