powered by:
Protein Alignment Mmp2 and CG14913
DIOPT Version :9
Sequence 1: | NP_995788.1 |
Gene: | Mmp2 / 35997 |
FlyBaseID: | FBgn0033438 |
Length: | 758 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097146.1 |
Gene: | CG14913 / 34532 |
FlyBaseID: | FBgn0032331 |
Length: | 499 |
Species: | Drosophila melanogaster |
Alignment Length: | 56 |
Identity: | 17/56 - (30%) |
Similarity: | 30/56 - (53%) |
Gaps: | 6/56 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 405 EEENRRRKIEHKSQWERNPSKERNRPRERQEMERRRQEQERQEQERQEQEDRRRER 460
|:.::..|.|.|.:| |||:...::|::||.:..|..::.|.|:..|.|.|
Fly 450 EKNSKAYKKEQKLEW------ERNKMAVQKELDRRARIFEAIDRLRIEEAQRHRGR 499
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1565 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.