DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and CG14913

DIOPT Version :9

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001097146.1 Gene:CG14913 / 34532 FlyBaseID:FBgn0032331 Length:499 Species:Drosophila melanogaster


Alignment Length:56 Identity:17/56 - (30%)
Similarity:30/56 - (53%) Gaps:6/56 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 EEENRRRKIEHKSQWERNPSKERNRPRERQEMERRRQEQERQEQERQEQEDRRRER 460
            |:.::..|.|.|.:|      |||:...::|::||.:..|..::.|.|:..|.|.|
  Fly   450 EKNSKAYKKEQKLEW------ERNKMAVQKELDRRARIFEAIDRLRIEEAQRHRGR 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 Peptidase_M10 143..301 CDD:278824
ZnMc_MMP 143..301 CDD:239805
HX 513..707 CDD:238046
CG14913NP_001097146.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.