DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and hpxa

DIOPT Version :9

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001315463.1 Gene:hpxa / 327588 ZFINID:ZDB-GENE-030131-5773 Length:447 Species:Danio rerio


Alignment Length:256 Identity:55/256 - (21%)
Similarity:100/256 - (39%) Gaps:56/256 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   496 PTVHRQHHHHNKPRKPKP---------------DSCM-TYYDAISI-IRGELFIFRGPYLWR--I 541
            |..|::.|.|    |.||               |.|. ..:||::: ..|..:.|:|.:|::  .
Zfish    20 PPQHKEDHSH----KGKPGGEGHKHELHHGAQLDRCKGIEFDAVAVNEEGVPYFFKGDHLFKGFH 80

  Fly   542 GTSGLYNGYPTEIRRHWSALPENLTKVDAVY--------ENKQRQIVFFIGREYYVFNSVMLAPG 598
            |.:.|.|....|:..|     .:|..|||.:        ::...|. ||:....:.:....|...
Zfish    81 GKAELSNKTFPELDDH-----HHLGHVDAAFRMHSEDSPDHHDHQF-FFLDNMVFSYFKHKLEKD 139

  Fly   599 FPKPLASL--GLPPTLTHIDASFVWGH----NNRTYMTSGTLYWRIDDYTGQVELDYPRDMSIWS 657
            :||.::::  |:|   .|:||:.....    |:......|...:..:.:|.:|:....:.|.   
Zfish   140 YPKLISAVFPGIP---DHLDAAVECPKPDCPNDTVIFFKGDEIYHFNMHTKKVDEKEFKSMP--- 198

  Fly   658 GVGYNIDAAFQYLDGKTYFFKNLGYWEFNDDRMKVAHARAKLSARRW-MQCARSANEVDDE 717
                |...||:|: |..|.|....:.:| |......|.:....||.: |:|....::..|:
Zfish   199 ----NCTGAFRYM-GHYYCFHGHQFSKF-DPMTGEVHGKYPKEARDYFMRCPHFGSKTTDD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 Peptidase_M10 143..301 CDD:278824
ZnMc_MMP 143..301 CDD:239805
HX 513..707 CDD:238046 47/227 (21%)
hpxaNP_001315463.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..44 7/27 (26%)
HX 49..243 CDD:238046 46/211 (22%)
Hemopexin 1 53..93 9/39 (23%)
Hemopexin 2 99..151 10/52 (19%)
Hemopexin 3 152..197 8/47 (17%)
Hemopexin 4 198..243 13/53 (25%)
HX 257..445 CDD:295316
Hemopexin 5 262..304
Hemopexin 6 305..351
Hemopexin 7 352..395
Hemopexin 8 396..441
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.