DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and Mmp23

DIOPT Version :9

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:XP_006538942.1 Gene:Mmp23 / 26561 MGIID:1347361 Length:420 Species:Mus musculus


Alignment Length:403 Identity:96/403 - (23%)
Similarity:151/403 - (37%) Gaps:135/403 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LPPEGSHSTAATRSKKAKTAISEDIMYNYLMQFDYLPKSDLETGALRTEDQLKEAIRSLQSFGNI 89
            |.||.|   .|.:.:....|:|...:.:.|...::|       ||     ..:.|.|:.|  ||:
Mouse     7 LRPEAS---GAVQGRWLGAALSGLCLLSALALLEWL-------GA-----PTETAWRAAQ--GNV 54

  Fly    90 TVTGEIDSATARLIQKPRCGVGDRRSADSFSPDNLYHEIGSNVRVRRFALQGPKWSRTDLT---- 150
            ... .:.|:||::.:.....| .||...:.:|..|                  :|...:||    
Mouse    55 DAP-NVGSSTAQVPRLLTMSV-TRRRRYTLTPARL------------------RWDHFNLTYRCH 99

  Fly   151 ------WSMVN---------------------RSMPDASKVERMVQTALDVWANHSKLTFREVYS 188
                  ||..|                     |::....:..|.:..|..:|::.|..:||||..
Mouse   100 LDQRGGWSGHNSDTNTDSNITAALHHRVLSFPRNLLSPEETRRGLAAAFRMWSDVSPFSFREVAP 164

  Fly   189 DQ-ADIQILFARRAHGD------GYKFDGPGQVLAHAFYPGEGRGGDAHFDADETWNFDGESDDS 246
            :: :|::|.|....|.|      .:.||||...|||||:|..   |..|||..|.|.. |.:..|
Mouse   165 ERPSDLKIGFYPVNHTDCLVSAVHHCFDGPTGELAHAFFPPH---GGIHFDDSEYWVL-GPTRYS 225

  Fly   247 HG-----TNFLNVALHELGHSLGLAHSAIPDAVMFPWYQNNEVAG--NLPDDDRYGIQQLYGTKE 304
            ..     ||.::||.||:||:|||.||....|:|   :.|..:.|  .|..|:.:|:.:|||..:
Mouse   226 WKKGVWLTNLVHVAAHEIGHALGLMHSQQDQALM---HLNATLRGWKALSQDELWGLHRLYGCLD 287

  Fly   305 K-----TWG--------------------------PYKPQTTTTTTTTTTMR------------- 325
            :     :|.                          |:....|||:.|.|..|             
Mouse   288 RIFVCASWARKGFCDVRQRLMKRLCPRSCDFCYEFPFPTVATTTSPTRTKTRLVREGRNMTFHCG 352

  Fly   326 -AMIYRADKPAYW 337
             .::::..| .||
Mouse   353 QKILHKKGK-VYW 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 Peptidase_M10 143..301 CDD:278824 59/202 (29%)
ZnMc_MMP 143..301 CDD:239805 59/202 (29%)
HX 513..707 CDD:238046
Mmp23XP_006538942.1 ZnMc_MMP 88..284 CDD:239805 59/202 (29%)
ShKT 285..319 CDD:214586 1/33 (3%)
Ig 343..403 CDD:386229 3/23 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10201
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.