DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and Mmp11

DIOPT Version :9

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_037112.2 Gene:Mmp11 / 25481 RGDID:3099 Length:491 Species:Rattus norvegicus


Alignment Length:614 Identity:179/614 - (29%)
Similarity:233/614 - (37%) Gaps:216/614 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 RCGVGDRRSADSFSPDNLYHEIGSNVRVRRFALQGPKWSRTDLT-------WSMVNRSMPDASKV 164
            ||||.|       .||.|    .:..|.:||.|.|.:|.:||||       |.:|.      .:|
  Rat    83 RCGVPD-------PPDVL----NARNRQKRFVLSGGRWEKTDLTYRILRFPWQLVR------EQV 130

  Fly   165 ERMVQTALDVWANHSKLTFREVYSDQADIQILFARRAHGDGYKFDGPGQVLAHAFYPGEGRGGDA 229
            .:.|..||.||:..:.|||.||:..:|||.|.|.|..|||...|||||.:|||||:|...|.||.
  Rat   131 RQTVAEALRVWSEVTPLTFTEVHEGRADIMIDFTRYWHGDNLPFDGPGGILAHAFFPKTHREGDV 195

  Fly   230 HFDADETWNFDGESDDSHGTNFLNVALHELGHSLGLAHSAIPDAVMFPWYQNNEVAGNLPDDDRY 294
            |||.||||....:     ||:.|.||.||.||.|||.|:....|:|.|:| ......:|..|||.
  Rat   196 HFDYDETWTIGDK-----GTDLLQVAAHEFGHVLGLQHTTAAKALMSPFY-TFRYPLSLSPDDRR 254

  Fly   295 GIQQLYGTKEKTWGPYKPQTTTTTTTTTTMRAMIYRADKPAYWPWNNPSNNPNNDRNRARERQEE 359
            |||.|||         :||.|.|:.|.|.                   |:....|.|..      
  Rat   255 GIQHLYG---------RPQLTPTSPTPTL-------------------SSQAGTDTNEI------ 285

  Fly   360 ERRRQEKERRRQEEERRHQEEERRRQVEERQRQEEERWRQEQERQEEENRRRKIEHKSQWERNPS 424
                                                                             
  Rat   286 ----------------------------------------------------------------- 285

  Fly   425 KERNRPRERQEMERRRQEQERQEQERQEQEDRRRERERDRQLEWERRNRNGAREPVTPTANTTPR 489
                                                              ..:||..|       
  Rat   286 --------------------------------------------------ALQEPEVP------- 293

  Fly   490 PTNKPYPTVHRQHHHHNKPRKPKPDSCMTYYDAISIIRGELFIFRGPYLWRIGTSGLYNGYPTEI 554
                                   |:.|.|.:||:|.||||||.|:..::||:.:..|..|||...
  Rat   294 -----------------------PEVCETSFDAVSTIRGELFFFKAGFVWRLRSGQLQPGYPALA 335

  Fly   555 RRHWSALPENLTKVDAVYENKQRQIVFFIGREYYVFNSVMLAPGFPKPLASLGLPPTLTHIDASF 619
            .|||..||   :.|||.:|:.|.||.||.|.:|:|::......| |.||:.|||..:..|  |:.
  Rat   336 SRHWQGLP---SPVDAAFEDAQGQIWFFQGAQYWVYDGEKPVLG-PAPLSKLGLQGSPVH--AAL 394

  Fly   620 VWG-HNNRTYMTSGTLYWRIDDYTGQVELDYPRDMSIWSGVGYNIDAAFQYLDGKTYFFKNLGYW 683
            ||| ..|:.|...|..|||....|.:|:...||..:.|.||...||||||..:|..||.:...||
  Rat   395 VWGPEKNKIYFFRGGDYWRFHPRTQRVDNPVPRRTTDWRGVPSEIDAAFQDAEGYAYFLRGHLYW 459

  Fly   684 EFNDDRMKVAHARAKLSARRWMQCARSAN 712
            :|:..::||..:..:.....:..||..||
  Rat   460 KFDPVKVKVLESFPRPIGPDFFDCAEPAN 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 Peptidase_M10 143..301 CDD:278824 73/164 (45%)
ZnMc_MMP 143..301 CDD:239805 73/164 (45%)
HX 513..707 CDD:238046 75/194 (39%)
Mmp11NP_037112.2 Cysteine switch. /evidence=ECO:0000250 82..89 5/12 (42%)
Peptidase_M10 108..261 CDD:395334 73/164 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..279 9/46 (20%)
HX 294..483 CDD:238046 75/194 (39%)
Hemopexin 1 298..342 20/43 (47%)
Hemopexin 2 343..385 18/45 (40%)
Hemopexin 3 387..435 16/49 (33%)
Hemopexin 4 436..483 14/46 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4331
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10201
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X44
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.