DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and Mmp7

DIOPT Version :9

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_036996.1 Gene:Mmp7 / 25335 RGDID:3100 Length:267 Species:Rattus norvegicus


Alignment Length:305 Identity:121/305 - (39%)
Similarity:163/305 - (53%) Gaps:48/305 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ATLLALFAQSMCIQELSLPPEGSHSTAATRSKKAKTAISEDIMYNYLMQFDYL--PKSDLETGAL 70
            |..|.|| :.:|:    ||  |..:...::.....||:..:...|||.:| ||  .|:...|.|:
  Rat     3 AMRLTLF-RIVCL----LP--GCLALPLSQEAGEVTALQWEQAQNYLRKF-YLHDSKTKKATSAV 59

  Fly    71 RTEDQLKEAIRSLQSFGNITVTGEIDSATARLIQKPRCGVGDRRSADSFSPDNLYHEIGSNVRVR 135
               |:|:|    :|.|..:..||::......::|||||||.|                     |.
  Rat    60 ---DKLRE----MQKFFGLPETGKLSPRVMEIMQKPRCGVPD---------------------VA 96

  Fly   136 RFAL--QGPKWSRTDLTWSMVNRSMPDASK--VERMVQTALDVWANHSKLTFREVYSDQADIQIL 196
            .|:|  ..|||....:|:.:|:.: .|..:  |:::|:.||.:|:....|.|:.|....|||.|.
  Rat    97 EFSLMPNSPKWHSRTVTYRIVSYT-TDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIG 160

  Fly   197 FARRAHGDGYKFDGPGQVLAHAFYPGEGRGGDAHFDADETWNFDGESDDSHGTNFLNVALHELGH 261
            |||..|||.:.|||||..|.|||.||.|.|||||||.||.|. |||  || |.|||.||.|||||
  Rat   161 FARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWT-DGE--DS-GVNFLFVATHELGH 221

  Fly   262 SLGLAHSAIPDAVMFPWYQNNEVAG-NLPDDDRYGIQQLYGTKEK 305
            ||||.||::|.:||:|.||.:.... :|..||..|||:|||.:.|
  Rat   222 SLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 Peptidase_M10 143..301 CDD:278824 80/160 (50%)
ZnMc_MMP 143..301 CDD:239805 80/160 (50%)
HX 513..707 CDD:238046
Mmp7NP_036996.1 PG_binding_1 34..85 CDD:396175 16/58 (28%)
Cysteine switch. /evidence=ECO:0000250 88..95 6/27 (22%)
Peptidase_M10 106..262 CDD:395334 80/160 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4331
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10201
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X44
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.