DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and Vtn

DIOPT Version :10

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_035837.1 Gene:Vtn / 22370 MGIID:98940 Length:478 Species:Mus musculus


Alignment Length:255 Identity:63/255 - (24%)
Similarity:97/255 - (38%) Gaps:89/255 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   466 LEWERRNRNGAREP--------VTPTANTTPRPT---------NKPYPTVHRQHH-------HHN 506
            :|..:.|.|...:|        :.|..:.|.:||         :.|.|.|.:|..       ...
Mouse    81 VEEPKNNTNTGVQPENTSPPGDLNPRTDGTLKPTAFLDPEEQPSTPAPKVEQQEEILRPDTTDQG 145

  Fly   507 KPRKPKPDSCM-TYYDAISIIR-GELFIFRGPYLWRIGTSGLYNGYPTEIRRHWSALPENLTKVD 569
            .|..|:.:.|. ..:||.:.:: |.||.|||.|.:.:..:.:..|||..|:..|           
Mouse   146 TPEFPEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDETAVRPGYPKLIQDVW----------- 199

  Fly   570 AVYENKQRQIVFFIGREYYVFNSVMLAPGFPKPLASLGLPPTLTHIDASFV-WGHNNRTYMTSGT 633
                                        |...|            |||:|. .....:||:..|:
Mouse   200 ----------------------------GIEGP------------IDAAFTRINCQGKTYLFKGS 224

  Fly   634 LYWRIDDYTGQVELDYPRDMSI-WSGVGYNIDAAF-----QYLDG--KTYFFKNLGYWEF 685
            .|||.:|  |.::..|||::|. :||:..|:||||     :| .|  :.||||...|||:
Mouse   225 QYWRFED--GVLDPGYPRNISEGFSGIPDNVDAAFALPAHRY-SGRERVYFFKGKQYWEY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 PG_binding_1 52..103 CDD:460223
Peptidase_M10 143..301 CDD:425668
HX 513..707 CDD:238046 49/184 (27%)
VtnNP_035837.1 Somatomedin_B 22..61 CDD:460034
Cell attachment site 64..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..153 14/70 (20%)
HX 153..473 CDD:238046 49/183 (27%)
Hemopexin 1 157..201 14/82 (17%)
Hemopexin 2 202..249 18/60 (30%)
Hemopexin 3 250..304 14/33 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 359..395
Heparin-binding. /evidence=ECO:0000250 366..399
Hemopexin 4 420..473
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.