DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and W01F3.2

DIOPT Version :9

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_507992.1 Gene:W01F3.2 / 180351 WormBaseID:WBGene00012185 Length:307 Species:Caenorhabditis elegans


Alignment Length:126 Identity:30/126 - (23%)
Similarity:57/126 - (45%) Gaps:28/126 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   567 KVDAVYENKQRQIVFFI-GREYYVF-----NSVMLAPGFPKPL-ASLGLPPTLTHIDASFVWGHN 624
            :|:....:.:|:|::.: ||..|.:     ::..|...|||.| :|:|..|     :|:..|.:.
 Worm   167 QVNGALYDPEREILWLVDGRSVYGYKKDGSDNWKLQSVFPKELPSSIGFTP-----EAAVRWHNK 226

  Fly   625 NRTYMTSGTLYWRIDDY------TGQVEL------DYPRDMSIWSGVG----YNIDAAFQY 669
            ::..:::|..:...|:|      ||:.|.      |..|.:|.|:..|    |.....|:|
 Worm   227 HQLLLSNGGKFALYDEYWNKSLMTGRTESYFENLPDRVRGISTWNSQGHAHIYTQSLVFEY 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 Peptidase_M10 143..301 CDD:278824
ZnMc_MMP 143..301 CDD:239805
HX 513..707 CDD:238046 30/126 (24%)
W01F3.2NP_507992.1 HX 122..299 CDD:295316 30/126 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10201
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.