DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and zmp-4

DIOPT Version :9

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_506678.2 Gene:zmp-4 / 179991 WormBaseID:WBGene00012364 Length:472 Species:Caenorhabditis elegans


Alignment Length:259 Identity:60/259 - (23%)
Similarity:103/259 - (39%) Gaps:40/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 YLMQFDYL---PKSDLETGALRTEDQLKEAIRSLQSFGNITVTGEIDSATARLIQKPRCGVGDRR 114
            ||.:|.|:   |..:::|....:|.|.|:|:...||......:|::|..|...:.:.||...|..
 Worm    40 YLFKFGYMIPEPHQNVKTIQEPSEKQTKDALIRFQSAFLYYSSGDVDVPTQAKMNEWRCANNDMD 104

  Fly   115 SADSFSPDNLYHEIGSNVRVRRFALQGPKWSRTDLTWSMVNRSMPDA---SKVERMVQTALDVWA 176
            ......|                |.:...|::..||:.:||  .|:.   :::......|.:.|.
 Worm   105 KGQPIPP----------------ASKKELWTKKSLTYKVVN--TPNTLSQAQIRSAAHEAFEQWT 151

  Fly   177 NHSKLTFREVYSDQADIQILFARRAHGDGYKFDGPGQVLAHAFYPGEGRGGDAHFDADETWNFDG 241
            ..|...|.|......||.|.|          :|.|...|..|....:........|.::.|.:  
 Worm   152 RASGFKFVETTGATPDITITF----------YDVPQSNLRIAGSASKPVNSHIILDKNQEWAY-- 204

  Fly   242 ESDDSHGTNFLNVALHELGHSLGLAHSAIPDAVMFPWYQ----NNEVAGNLPDDDRYGIQQLYG 301
            :|....|.:..:..|||:||.|||.|:....::|.|.::    .:.....:|:.||..|:::||
 Worm   205 KSQAPMGISLYHTLLHEIGHILGLPHTFYRGSIMHPIFKPVLLPHGTVDTVPNVDRLAIRKIYG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 Peptidase_M10 143..301 CDD:278824 38/164 (23%)
ZnMc_MMP 143..301 CDD:239805 38/164 (23%)
HX 513..707 CDD:238046
zmp-4NP_506678.2 Peptidase_M10 118..268 CDD:334067 38/163 (23%)
HX 283..471 CDD:238046
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10201
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.