DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and zmp-6

DIOPT Version :9

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_498599.1 Gene:zmp-6 / 176025 WormBaseID:WBGene00020646 Length:279 Species:Caenorhabditis elegans


Alignment Length:274 Identity:78/274 - (28%)
Similarity:119/274 - (43%) Gaps:60/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 RSADSFSPDNLYHEIGSNVRVRRFALQGPKWSRTDLTWSMVNRSM--PDASKVERMVQTALDVWA 176
            ::.|...|      ||...|.:|:.::..:|.:..|||.:..:::  ||...|...:..|.:.|:
 Worm    25 KNLDFIKP------IGFGSREKRYVIRAKRWKKHTLTWQLQTQNLLDPDVFIVRNTMHRAFNEWS 83

  Fly   177 NHSKLTFREVYSD-----QADIQILFARRAHGDGYKFDGPGQVLAHAFYPGEGRGGDAHFDADET 236
            ..|.:.|||:..|     ..||.|.|.:..|.||:.|||...|:||||||.:||   .||||:|.
 Worm    84 TVSSVDFREIPPDLVTKQPPDIYIAFEKGEHSDGFPFDGQDGVVAHAFYPRDGR---LHFDAEEQ 145

  Fly   237 WNFDGESDDSHGTNFLNVALHELGHSLGLAHSAIPDAVMFPWYQNNEVAGNLPDDDRYGIQQLY- 300
            |:.    :...|.|....|:||:||.|||.||....|.||...:..:.|..|.|||...|:.|: 
 Worm   146 WSL----NSVEGVNLFQTAVHEIGHLLGLEHSMDVRAAMFAAKRPYDPAFTLGDDDVRAIRSLFP 206

  Fly   301 ----------------------------GTKEKTWGPYKPQTTTTTTTTTTMRAMIYRADKPAYW 337
                                        |..|:...|:...:|||::::           ..:::
 Worm   207 INETDANSGSEENSEDPVTTVKPISKEEGIDEENNDPFDASSTTTSSSS-----------PDSFF 260

  Fly   338 PWNNPSNNPNNDRN 351
            |:..||......||
 Worm   261 PFPLPSIEHFQRRN 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 Peptidase_M10 143..301 CDD:278824 61/193 (32%)
ZnMc_MMP 143..301 CDD:239805 61/193 (32%)
HX 513..707 CDD:238046
zmp-6NP_498599.1 ZnMc_MMP 48..205 CDD:239805 60/163 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10201
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3504
SonicParanoid 1 1.000 - - X44
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.