DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and Mmp7

DIOPT Version :9

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_034940.2 Gene:Mmp7 / 17393 MGIID:103189 Length:267 Species:Mus musculus


Alignment Length:304 Identity:113/304 - (37%)
Similarity:155/304 - (50%) Gaps:50/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ATLLALFAQSMCI--QELSLP-PEGSHSTAATRSKKAKTAISEDIMYNYLMQFDYLPKSDLETGA 69
            |..|.||. .:|:  ..|:|| .:.:...:|.:.::|:         |||.:|  .|........
Mouse     3 AMQLTLFC-FVCLLPGHLALPLSQEAGDVSAHQWEQAQ---------NYLRKF--YPHDSKTKKV 55

  Fly    70 LRTEDQLKEAIRSLQSFGNITVTGEIDSATARLIQKPRCGVGDRRSADSFSPDNLYHEIGSNVRV 134
            ....|.|||    :|.|..:.:||::......::|||||||.|                     |
Mouse    56 NSLVDNLKE----MQKFFGLPMTGKLSPYIMEIMQKPRCGVPD---------------------V 95

  Fly   135 RRFAL--QGPKWSRTDLTWSMVNRSMPDASK--VERMVQTALDVWANHSKLTFREVYSDQADIQI 195
            ..::|  ..|||....:|:.:|:.: .|..:  |:::|:.||.:|:....|.|:.|....|||.|
Mouse    96 AEYSLMPNSPKWHSRIVTYRIVSYT-SDLPRIVVDQIVKKALRMWSMQIPLNFKRVSWGTADIII 159

  Fly   196 LFARRAHGDGYKFDGPGQVLAHAFYPGEGRGGDAHFDADETWNFDGESDDSHGTNFLNVALHELG 260
            .||||.|||.:.|||||..|.|||.||.|.|||||||.||.|. |||   ..|.|||..|.||.|
Mouse   160 GFARRDHGDSFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWT-DGE---DAGVNFLFAATHEFG 220

  Fly   261 HSLGLAHSAIPDAVMFPWYQNNEVAG-NLPDDDRYGIQQLYGTK 303
            |||||:||::|..||:|.||.:.... :|..||..|||:|||.:
Mouse   221 HSLGLSHSSVPGTVMYPTYQRDYSEDFSLTKDDIAGIQKLYGKR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 Peptidase_M10 143..301 CDD:278824 77/160 (48%)
ZnMc_MMP 143..301 CDD:239805 77/160 (48%)
HX 513..707 CDD:238046
Mmp7NP_034940.2 PG_binding_1 34..85 CDD:279773 14/65 (22%)
Peptidase_M10 106..262 CDD:278824 77/160 (48%)
ZnMc_MMP 106..262 CDD:239805 77/160 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10201
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X44
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.