DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and Hpx

DIOPT Version :9

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_059067.2 Gene:Hpx / 15458 MGIID:105112 Length:460 Species:Mus musculus


Alignment Length:334 Identity:86/334 - (25%)
Similarity:131/334 - (39%) Gaps:96/334 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   413 IEHKSQWERNPSKERN-RPRERQE------------MERRRQEQERQ-----EQERQEQED--RR 457
            |:....|...|.|:.| .|:..||            :|..|.|.:.:     :..|:...|  .|
Mouse   110 IKEDKVWVYPPEKKENGYPKLFQEEFPGIPYPPDAAVECHRGECQSEGVLFFQGNRKWFWDFATR 174

  Fly   458 RERERD--------RQLEWERR------NRNGAREPVTPTANTTPRPTNKPYPTVHRQH------ 502
            .::||.        ..|.|..|      |:.....||  |....||     ||...|.:      
Mouse   175 TQKERSWSTVGNCTAALRWLERYYCFQGNKFLRFNPV--TGEVPPR-----YPLDARDYFVSCPG 232

  Fly   503 HHHNKPR--------------KPKPDSCMTYYDAISIIRGELFIFRGPYLWRIGTS--GLYNGYP 551
            ..|.:||              :..||..:|  ..:|..||..:.|.|.:.||:.:|  | ::.:|
Mouse   233 RGHGRPRNGTAHGNSTHPMHSRCSPDPGLT--ALLSDHRGATYAFTGSHYWRLDSSRDG-WHSWP 294

  Fly   552 TEIRRHWSALPENLTKVDAVYENKQRQIVFFI-GREYYVF-----NSVMLAPGFPKPL-ASLGLP 609
              |..||   |:..:.|||.:....:  |:.| |.:.|||     |:  |..|:||.| ..||.|
Mouse   295 --IAHHW---PQGPSTVDAAFSWDDK--VYLIQGTQVYVFLTKGGNN--LVSGYPKRLEKELGSP 350

  Fly   610 P--TLTHIDASFVWGHNNRTYMTSGTLYWRIDDYTGQVELDYPRDMSIWSGVGYNIDAAFQYLDG 672
            |  :|..|||:|....::|.|::||...|.:|..:|.        .:.|:.|.:    ..:.:||
Mouse   351 PGISLETIDAAFSCPGSSRLYVSSGRRLWWLDLKSGA--------QATWTEVSW----PHEKVDG 403

  Fly   673 KTYFFKNLG 681
            .....|:||
Mouse   404 ALCLDKSLG 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 Peptidase_M10 143..301 CDD:278824
ZnMc_MMP 143..301 CDD:239805
HX 513..707 CDD:238046 55/180 (31%)
HpxNP_059067.2 HX 47..230 CDD:238046 28/126 (22%)
Hemopexin 1 53..93
Hemopexin 2 94..138 8/27 (30%)
Hemopexin 3 139..183 8/43 (19%)
Hemopexin 4 184..230 12/52 (23%)
HX 253..458 CDD:238046 55/184 (30%)
Hemopexin 5 257..302 17/52 (33%)
Hemopexin 6 303..350 17/50 (34%)
Hemopexin 7 355..394 13/46 (28%)
Hemopexin 8 398..448 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.