DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and MMP24

DIOPT Version :10

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_006681.1 Gene:MMP24 / 10893 HGNCID:7172 Length:645 Species:Homo sapiens


Alignment Length:49 Identity:12/49 - (24%)
Similarity:16/49 - (32%) Gaps:17/49 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 RPTSPGHGRASVTRDSPEPDTTTHGNHSTPTSALRRLYFKTARASKAAK 125
            :|.:||       :.||    ....|..|..|.      |..:.||..|
Human    92 QPPAPG-------KQSP----GCRKNRGTSKSG------KKGKGSKGCK 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 PG_binding_1 52..103 CDD:460223 5/25 (20%)
Peptidase_M10 143..301 CDD:425668
HX 513..707 CDD:238046
MMP24NP_006681.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
PG_binding_1 82..134 CDD:460223 12/49 (24%)
Cysteine switch. /evidence=ECO:0000250 137..144
Peptidase_M10 162..327 CDD:425668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 323..380
HX 377..569 CDD:238046
Hemopexin 1 377..425
Hemopexin 2 426..471
Hemopexin 3 473..521
Hemopexin 4 522..569
DUF3377 575..645 CDD:463374
PDZ-binding 643..645
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.