DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and BSPH1

DIOPT Version :10

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001121798.1 Gene:BSPH1 / 100131137 HGNCID:33906 Length:132 Species:Homo sapiens


Alignment Length:96 Identity:18/96 - (18%)
Similarity:33/96 - (34%) Gaps:42/96 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   621 WGHNNRTYMTSGTLYWRI---DDYTGQVELDYPRDMSIWSGVGYNIDAAFQYLDGKTYFFKNLGY 682
            |...|:||  .|  ||:.   :|:...|   :|                        ::::.|.|
Human    68 WCSLNKTY--EG--YWKFCSAEDFANCV---FP------------------------FWYRRLIY 101

  Fly   683 WEFNDDRMKVAHARAKLSARRWMQCARSANE 713
            ||..||        .:...::|....::.|:
Human   102 WECTDD--------GEAFGKKWCSLTKNFNK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 PG_binding_1 52..103 CDD:460223
Peptidase_M10 143..301 CDD:425668
HX 513..707 CDD:238046 17/88 (19%)
BSPH1NP_001121798.1 fn2 45..82 CDD:459645 7/17 (41%)
fn2 90..131 CDD:459645 10/70 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.