DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and SEC14L5

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_055507.1 Gene:SEC14L5 / 9717 HGNCID:29032 Length:696 Species:Homo sapiens


Alignment Length:354 Identity:77/354 - (21%)
Similarity:134/354 - (37%) Gaps:94/354 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SLSPELAKKAHDELGEIPDRIDED-IE---------------TLRTWISKQPHLKARQDAQFLVA 59
            :|.|.|...:.|     .|::|.| ||               .||.|:.:....|..:| :.::.
Human   211 TLGPALEAVSMD-----GDKLDADYIERCLGHLTPMQESCLIQLRHWLQETHKGKIPKD-EHILR 269

  Fly    60 FLRGCKYSLEKTKLKLDNFYAMRGAVPELYKNRIVGEKQLSILDTGCLLRLPQP----------- 113
            |||...:.|:|.:              |:.:..:...||..:   ..||:..||           
Human   270 FLRAHDFHLDKAR--------------EMLRQSLSWRKQHQV---DLLLQTWQPPALLEEFYAGG 317

  Fly   114 ---LQADGPRIHISRYGQYDSK--------KYSIAEVVQVNTMLGEIQIREDDNAM-----ISGF 162
               ...||..::|.|.||.|:|        :..:..|:.||.   |.|.|.:.:..     ||.:
Human   318 WHYQDIDGRPLYILRLGQMDTKGLMKAVGEEALLRHVLSVNE---EGQKRCEGSTRQLGRPISSW 379

  Fly   163 VEIIDMKGVGAGHLFQFDA-VLVKKLAVLGDKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKI 226
            ..::|::|:...||::... .|::.:.|:.|. ||........|.||.......::....::|..
Human   380 TCLLDLEGLNMRHLWRPGVKALLRMIEVVEDN-YPETLGRLLIVRAPRVFPVLWTLISPFINENT 443

  Fly   227 RKRFHIHSKLD-----SLYKYVPKECLPAEYGGSNGTIQDVVSTWRTKLLAYKPFFEEEASYGTN 286
            |::|.|:|..:     .|..|:.:|.:|...||     :.|.:.....|:....:..||....|:
Human   444 RRKFLIYSGSNYQGPGGLVDYLDREVIPDFLGG-----ESVCNVPEGGLVPKSLYMTEEEQEHTD 503

  Fly   287 E-----------KLRRGQP--VSAESLFG 302
            :           .:.||.|  |:.|.|.|
Human   504 QLWQWSETYHSASVLRGAPHEVAVEILEG 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 14/60 (23%)
SEC14 117..254 CDD:238099 37/155 (24%)
SEC14L5NP_055507.1 PRELI 17..173 CDD:309720
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..214 1/2 (50%)
CRAL_TRIO_N 243..288 CDD:215024 11/59 (19%)
SEC14 306..479 CDD:214706 40/181 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.