DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and PDR17

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_014135.1 Gene:PDR17 / 855457 SGDID:S000005208 Length:350 Species:Saccharomyces cerevisiae


Alignment Length:266 Identity:53/266 - (19%)
Similarity:86/266 - (32%) Gaps:109/266 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKTKLKLDNFYAMRGAVPELYKNRI 93
            ||...|.|  :.|:|::..|:          :||..|::...         |::|....|...|.
Yeast    79 DRPLSDWE--KFWLSRECFLR----------YLRANKWNTAN---------AIKGLTKTLVWRRE 122

  Fly    94 VG------EKQLSILDTGCLLRLPQPLQAD--------GPRIHISRYGQYDSKK---YSIAEVVQ 141
            :|      :|              .||.||        |.::.:.    :|:.|   |.:....|
Yeast   123 IGLTHGKEDK--------------DPLTADKVAVENETGKQVILG----FDNAKRPLYYMKNGRQ 169

  Fly   142 VNTMLGEIQIREDDNAM----------ISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDKA-- 194
             ||.....|::|....|          :.....::|.|.             .|:..::.|||  
Yeast   170 -NTESSFRQVQELVYMMETATTVAPQGVEKITVLVDFKS-------------YKEPGIITDKAPP 220

  Fly   195 --------------YPYRPKGFHFVNAPSSAEKFMSI----------AKSLMSEKIRKRFHIH-S 234
                          ||.|......:|.|..|..|:.:          ||::..|....  ||. |
Yeast   221 ISIARMCLNVMQDHYPERLAKCVLINIPWFAWAFLKMMYPFLDPATKAKAIFDEPFEN--HIEPS 283

  Fly   235 KLDSLY 240
            :||:||
Yeast   284 QLDALY 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 8/44 (18%)
SEC14 117..254 CDD:238099 34/172 (20%)
PDR17NP_014135.1 CRAL_TRIO_N 49..115 CDD:397711 12/56 (21%)
CRAL_TRIO 146..291 CDD:395525 33/164 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343338
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.