DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and YKL091C

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_012832.1 Gene:YKL091C / 853771 SGDID:S000001574 Length:310 Species:Saccharomyces cerevisiae


Alignment Length:257 Identity:58/257 - (22%)
Similarity:111/257 - (43%) Gaps:34/257 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKTK---LKLDNFYAMRGA-- 84
            |.:....:|.:...|: |..:.:.|.|.|...|:.|||..|:.:..:.   ::.:.:....||  
Yeast    23 GNLTKEQEEALLQFRS-ILLEKNYKERLDDSTLLRFLRARKFDINASVEMFVETERWREEYGANT 86

  Fly    85 VPELYKNRIVGEKQLSILDTGCLLRL-PQ---PLQADGPRIHISRYGQYDSKK-YSI-AEVVQVN 143
            :.|.|:|....|.:..|.    |.:: ||   .:..||..::....|..:.|| |.| .|...:.
Yeast    87 IIEDYENNKEAEDKERIK----LAKMYPQYYHHVDKDGRPLYFEELGGINLKKMYKITTEKQMLR 147

  Fly   144 TMLGEIQI----REDDNAMISGFV-----EIIDMKGV---GAGHLFQFDAVLVKKLAVLGDKAYP 196
            .::.|.::    |....:..:|::     .::|:||:   .|.|:..:    :|.:|.:....||
Yeast   148 NLVKEYELFATYRVPACSRRAGYLIETSCTVLDLKGISLSNAYHVLSY----IKDVADISQNYYP 208

  Fly   197 YRPKGFHFVNAPSSAEKFMSIAKSLMSE-KIRKRFHIHSKL-DSLYKYVPKECLPAEYGGSN 256
            .|...|:.:::|........:.|..:.. .:.|.|.:.|.. ..|.|.:|.|.||.:|||::
Yeast   209 ERMGKFYIIHSPFGFSTMFKMVKPFLDPVTVSKIFILGSSYKKELLKQIPIENLPVKYGGTS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 11/47 (23%)
SEC14 117..254 CDD:238099 34/152 (22%)
YKL091CNP_012832.1 CRAL_TRIO_N 30..75 CDD:215024 11/45 (24%)
SEC14 101..271 CDD:214706 40/178 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.