DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and TTPAL

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001034288.1 Gene:TTPAL / 79183 HGNCID:16114 Length:342 Species:Homo sapiens


Alignment Length:297 Identity:89/297 - (29%)
Similarity:143/297 - (48%) Gaps:22/297 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SLSPELAKKAHDELGEIPDRIDEDIETLRTWISKQ-PHLKARQDAQFLVAFLRGCKYSLEKTKLK 74
            ||:.:|..||.:||.|.|:....|::.||..:.|: |:|....|..||:.|||..|:..::....
Human    34 SLTEDLVTKAREELQEKPEWRLRDVQALRDMVRKEYPNLSTSLDDAFLLRFLRARKFDYDRALQL 98

  Fly    75 LDNFYAMRGAVPELYKNRIVGEKQLSILDTGCLLRLPQPLQADGPRIHI--SRYGQYDSKKYSIA 137
            |.|:::.|.:.||:: |.:.......:|.:|.|..||   ..|....|:  .|..::....|.|.
Human    99 LVNYHSCRRSWPEVF-NNLKPSALKDVLASGFLTVLP---HTDPRGCHVVCIRPDRWIPSNYPIT 159

  Fly   138 EVVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDKAYPYRPKGF 202
            |.::...:..| ::.:.:...::|.|.:.|.|||.......|...:.||:..:....:|.|.|..
Human   160 ENIRAIYLTLE-KLIQSEETQVNGIVILADYKGVSLSKASHFGPFIAKKVIGILQDGFPIRIKAV 223

  Fly   203 HFVNAPSSAEKFMSIAKSLMSEKIRKRFHIH-SKLDSLYKYVPKECLPAEYGGSNGTIQDVVSTW 266
            |.||.|...:...:|.|..:.|||..||.:| |.|:||:..:|:..||.||||:.|.:.  .:||
Human   224 HVVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLPRSILPKEYGGTAGELD--TATW 286

  Fly   267 RTKLLAYKPFFEEEASYGTNEKLRRGQPVSA-ESLFG 302
            ...|||.:..|.:|..          |||.| :|:.|
Human   287 NAVLLASEDDFVKEFC----------QPVPACDSILG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 14/45 (31%)
SEC14 117..254 CDD:238099 40/139 (29%)
TTPALNP_001034288.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
CRAL_TRIO_N 56..102 CDD:215024 14/45 (31%)
SEC14 121..277 CDD:238099 46/159 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.