DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and Sec14l1

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_083053.2 Gene:Sec14l1 / 74136 MGIID:1921386 Length:719 Species:Mus musculus


Alignment Length:263 Identity:54/263 - (20%)
Similarity:102/263 - (38%) Gaps:63/263 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LGEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKTKLKLDNFYAMRGAVPEL 88
            ||::....:..:..||.|:.:....|..:| :.::.|||...::::|.:              |:
Mouse   248 LGDLTPLQESCLIRLRQWLQETHKGKIPKD-EHILRFLRARDFNIDKAR--------------EI 297

  Fly    89 YKNRIVGEKQLS---ILDTGCLLRLPQPL-----------QADGPRIHISRYGQYDSKKYSIAEV 139
            ....:...||..   ||||   ...||.|           ..||..:::.|.||.|:|....|  
Mouse   298 MCQSLTWRKQHQVDYILDT---WTPPQVLLDYYAGGWHHHDKDGRPLYVLRLGQMDTKGLVRA-- 357

  Fly   140 VQVNTMLGE-------IQIRE------DDNAM-----ISGFVEIIDMKGVGAGHLFQFDAVLVKK 186
                  |||       :.|.|      ::|..     ||.:..::|::|:...||::.....:.:
Mouse   358 ------LGEEALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLR 416

  Fly   187 LAVLGDKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHIHSKLD-----SLYKYVPKE 246
            :..:.:..||........:.||.......::....:.:..|::|.|::..|     .|..|:.||
Mouse   417 IIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKE 481

  Fly   247 CLP 249
            .:|
Mouse   482 IIP 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 9/44 (20%)
SEC14 117..254 CDD:238099 33/156 (21%)
Sec14l1NP_083053.2 Required for interaction and inhibitory function toward DDX58. /evidence=ECO:0000250|UniProtKB:Q92503 1..510 54/263 (21%)
PRELI 17..173 CDD:282550
CRAL_TRIO_N 256..301 CDD:215024 10/59 (17%)
CRAL_TRIO 326..490 CDD:279044 33/167 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.