DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and SEC14L6

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_016884420.1 Gene:SEC14L6 / 730005 HGNCID:40047 Length:432 Species:Homo sapiens


Alignment Length:306 Identity:55/306 - (17%)
Similarity:100/306 - (32%) Gaps:87/306 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SNSIRSLSP-------ELAKKAHDELGEIPDRIDE-----------DIETLRTWISKQPHLKARQ 52
            |..:..|||       :..:...|.|..:|:..|.           |::.....:.|....:.:|
Human     5 SGQVGDLSPSQEKSLAQFRENIQDVLSALPNPDDYFLLRWLQARSFDLQKSEDMLRKHMEFRKQQ 69

  Fly    53 DAQFLVAFL---------------------------------RGCKYSLEKTKLKLDNFYAMRGA 84
            |...::|:.                                 :|...|..|.:|..|:|      
Human    70 DLANILAWQPPEVVRLYNANGICGHDGEGSPVWYHIVGSLDPKGLLLSASKQELLRDSF------ 128

  Fly    85 VPELYKNRIVGEKQLSILDTGCLLRLPQPLQADGPRIH--ISRYGQYDSKKYSIAEVVQVNTMLG 147
                        :...:|...|.|:..:|....|..|.  :.|.|             ..||.:.
Human   129 ------------RSCELLLRECELQSQKPHWTRGTGISAPLDRRG-------------NCNTAIW 168

  Fly   148 EIQIREDD-NAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDKAYPYRPKGFHFVNAPSSA 211
            ....|..: ...:...:.|..::|:|...|::....|:::.....:..||...|....|.||...
Human   169 PPMDRHKELGKRVEKIIAIFGLEGLGLRDLWKPGIELLQEFFSALEANYPEILKSLIVVRAPKLF 233

  Fly   212 EKFMSIAKSLMSEKIRKRFHI--HSKLDSLYKYVPKECLPAEYGGS 255
            ....::.||.|||:.|::..|  .:....|.|::..:.||.|:||:
Human   234 AVAFNLVKSYMSEETRRKVVILGDNWKQELTKFISPDQLPVEFGGT 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 10/88 (11%)
SEC14 117..254 CDD:238099 30/141 (21%)
SEC14L6XP_016884420.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.