DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and Sec14l2

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_653103.1 Gene:Sec14l2 / 67815 MGIID:1915065 Length:403 Species:Mus musculus


Alignment Length:268 Identity:60/268 - (22%)
Similarity:105/268 - (39%) Gaps:43/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SNSIRSLSPELAKKAHDELGEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEK 70
            |..:..|||    |..:.|.:..:.:.:.:.||           ...|..||:.:||...:.|:|
Mouse     2 SGRVGDLSP----KQEEALAKFRENVQDVLPTL-----------PNPDDYFLLRWLRARSFDLQK 51

  Fly    71 TKLKLDNFYAMR----------GAVPELYKNRIVGEKQLSILDTGCLL--RLPQPLQADGPRIHI 123
            ::..|......|          ...||:.:..:.|.:....|| ||.:  .:..||.|.|.....
Mouse    52 SEAMLRKHVEFRKQKDIDKIISWQPPEVIQQYLSGGRCGYDLD-GCPVWYDIIGPLDAKGLLFSA 115

  Fly   124 SRYGQYDSK----KYSIAEVVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAVLV 184
            |:.....:|    :..:.|.:|..|.||:         .|.....|.|.:|:|..||::......
Mouse   116 SKQDLLRTKMRDCELLLQECIQQTTKLGK---------KIETITMIYDCEGLGLKHLWKPAVEAY 171

  Fly   185 KKLAVLGDKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHI--HSKLDSLYKYVPKEC 247
            .:...:.::.||...|....|.||.......::.|..:||..|::..:  .:..:.|.|::..:.
Mouse   172 GEFLTMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRRKIMVLGANWKEVLLKHISPDQ 236

  Fly   248 LPAEYGGS 255
            ||.||||:
Mouse   237 LPVEYGGT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 10/44 (23%)
SEC14 117..254 CDD:238099 31/142 (22%)
Sec14l2NP_653103.1 CRAL_TRIO_N 13..59 CDD:215024 11/56 (20%)
SEC14 76..244 CDD:214706 42/177 (24%)
GOLD_2 300..381 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.