DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and Sec14l5

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001121197.1 Gene:Sec14l5 / 665119 MGIID:3616084 Length:696 Species:Mus musculus


Alignment Length:266 Identity:63/266 - (23%)
Similarity:108/266 - (40%) Gaps:55/266 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LGEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKTKLKLDNFYAMRGAVPEL 88
            ||.:....:..:..||.|:.:....|..:| :.::.|||...:.|:|.:..|....:.|      
Mouse   235 LGHLSPMQESCLVQLRHWLQETHKGKIPKD-EHILRFLRARDFHLDKARDMLCQSLSWR------ 292

  Fly    89 YKNRIVGEKQLSI---LDTGCLLRLPQPLQ-----------ADGPRIHISRYGQYDSK------- 132
                    ||..:   |.|   .|.|.|||           .||..::|.|.||.|:|       
Mouse   293 --------KQHQVDLLLQT---WRPPPPLQEFYAGGWHYQDIDGRPLYILRLGQMDTKGLMKAVG 346

  Fly   133 -KYSIAEVVQVNTMLGEIQIREDDNAM-----ISGFVEIIDMKGVGAGHLFQFDA-VLVKKLAVL 190
             :..:..|:.||.   |.|.|.:.|..     ||.:..::|::|:...||::... .|::.:.|:
Mouse   347 EEALLQHVLSVNE---EGQKRCEGNTRQFGRPISSWTCLLDLEGLNMRHLWRPGVKALLRMIEVV 408

  Fly   191 GDKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHIHSKLD-----SLYKYVPKECLPA 250
            .|. ||........|.||.......::....::|..|::|.|:|..:     .|..|:.|:.:|.
Mouse   409 EDN-YPETLGRLLIVRAPRVFPVLWTLVSPFINENTRRKFLIYSGSNYQGPGGLVDYLDKDVIPD 472

  Fly   251 EYGGSN 256
            ..||.:
Mouse   473 FLGGES 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 11/44 (25%)
SEC14 117..254 CDD:238099 38/155 (25%)
Sec14l5NP_001121197.1 PRELI 17..173 CDD:368069
CRAL_TRIO_N 243..288 CDD:215024 11/45 (24%)
SEC14 306..479 CDD:214706 44/177 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.