DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and RLBP1

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_016877949.1 Gene:RLBP1 / 6017 HGNCID:10024 Length:326 Species:Homo sapiens


Alignment Length:261 Identity:56/261 - (21%)
Similarity:111/261 - (42%) Gaps:37/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KKAHDELGEIPDRIDEDIETLRTWISKQ-----------PHLKARQDAQFLVAFLRGCKYSLEKT 71
            :||.|||.|..:..:|.:..|:..:..|           ......:|:.|.:.|:|..|:::.:.
Human    55 QKAKDELNEREETREEAVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFIRARKFNVGRA 119

  Fly    72 KLKLDNFYAMRGAVPELYKNRIVGEKQLSILDTGCLLRLPQPLQADGPRIHISR--YGQ------ 128
            ...|..:...|...|||:.:       ||.....|      .::|..|.:..||  ||:      
Human   120 YELLRGYVNFRLQYPELFDS-------LSPEAVRC------TIEAGYPGVLSSRDKYGRVVMLFN 171

  Fly   129 ---YDSKKYSIAEVVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVL 190
               :.|::.:..|::|....:.| ::.|::...|:||..|.:.||.............::|:..:
Human   172 IENWQSQEITFDEILQAYCFILE-KLLENEETQINGFCIIENFKGFTMQQAASLRTSDLRKMVDM 235

  Fly   191 GDKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHIH-SKLDSLYKYVPKECLPAEYGG 254
            ...::|.|.|..||::.|.......::.|..:..|:.:|..:| ..|...|:.:.:..||:::||
Human   236 LQDSFPARFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSDFGG 300

  Fly   255 S 255
            :
Human   301 T 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 9/55 (16%)
SEC14 117..254 CDD:238099 31/148 (21%)
RLBP1XP_016877949.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145912
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.