DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and clvs2

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001020716.1 Gene:clvs2 / 566769 ZFINID:ZDB-GENE-041014-313 Length:329 Species:Danio rerio


Alignment Length:291 Identity:82/291 - (28%)
Similarity:136/291 - (46%) Gaps:41/291 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSPELAKKAHDELGEIPDRIDEDIETLRTWISKQPHLK-ARQDAQFLVAFLRGCKYSLEKTKLKL 75
            ||||..:||..||.|.||.:.:||:.:|..|..:|.:. .|.|..|::.|||..|::..:....|
Zfish     8 LSPETLEKAKVELKENPDTLHQDIQEVRDMIITRPDIGFLRTDDAFILRFLRARKFNHFEAFRLL 72

  Fly    76 DNFYAMRGAVPELYKNRIVGEKQLSILDTGCLLRLPQPLQADGPRI--HISRYGQ---------Y 129
            ..::..|....:::||       |...|.|    :.|.|:...|.:  ::.|||:         :
Zfish    73 AQYFEYRQQNLDMFKN-------LKATDPG----IKQALKDGFPGVLSNLDRYGRKILVLFAANW 126

  Fly   130 DSKKYSIAEVVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAV-----LVKKLAV 189
            |..:|:..::::...:..|..| ||....::|||.|||...      |.|...     .:.:||:
Zfish   127 DQSRYTFVDILRAILLSLEAMI-EDPELQVNGFVLIIDWSN------FTFKQASKLTPSMLRLAI 184

  Fly   190 LG-DKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHIH-SKLDSLYKYVPKECLPAEY 252
            .| ..::|.|..|.||||.|.......::.:..:.:|.|||..:| :.|:||::.:..|.||:|.
Zfish   185 EGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKDKTRKRIFMHGNNLNSLHQLILPEILPSEL 249

  Fly   253 GGSNGTIQDVVSTWRTKLLAYKPFFEEEASY 283
            ||......  :.||...||.:.  ::||..|
Zfish   250 GGMLPPYD--MGTWARTLLDHA--YDEETDY 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 13/45 (29%)
SEC14 117..254 CDD:238099 41/154 (27%)
clvs2NP_001020716.1 CRAL_TRIO_N 29..75 CDD:215024 13/45 (29%)
SEC14 106..251 CDD:238099 40/151 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..329
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579377
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.