DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and Ttpa

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_056582.1 Gene:Ttpa / 50500 MGIID:1354168 Length:278 Species:Mus musculus


Alignment Length:261 Identity:70/261 - (26%)
Similarity:122/261 - (46%) Gaps:31/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ELGEIPDR---IDEDIETLRTWISK-------QPHLKARQDAQFLVAFLRGCKYSLEKTKLKLDN 77
            :|.|:||.   :...:..||..:.:       ||...|     ||:.|||...:.|:.....:.|
Mouse    13 QLNELPDHSPLLQPGLAELRRRVQEAGVPQTPQPLTDA-----FLLRFLRARDFDLDLAWRLMKN 72

  Fly    78 FYAMRGAVPEL---YKNRIVGEKQLSILDTGC--LLRLPQPLQADGPRIHISRYGQYDSKKYSIA 137
            :|..|...|||   .:.|.:    |.:|..|.  :||   ...:.|.|:.|.|...:|.|.::..
Mouse    73 YYKWRAECPELSADLRPRSI----LGLLKAGYHGVLR---SRDSTGSRVLIYRIAYWDPKVFTAY 130

  Fly   138 EVVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDKAYPYRPKGF 202
            :|.:|:.:..|:.::|.:... :|...|.|::|....|.||....:.||:|.:...::|.:.:|.
Mouse   131 DVFRVSLITSELIVQEVETQR-NGVKAIFDLEGWQVSHAFQITPSVAKKIAAVLTDSFPLKVRGI 194

  Fly   203 HFVNAPSSAEKFMSIAKSLMSEKIRKRFHIHSK--LDSLYKYVPKECLPAEYGGSNGTIQDVVST 265
            |.:|.|.......|:.|..::|||:.|.|:|..  ..|:.::.| :.||.||||...:::|:...
Mouse   195 HLINEPVIFHAVFSMIKPFLTEKIKDRIHLHGNNYKSSMLQHFP-DILPREYGGKEFSMEDICQE 258

  Fly   266 W 266
            |
Mouse   259 W 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 11/51 (22%)
SEC14 117..254 CDD:238099 39/138 (28%)
TtpaNP_056582.1 CRAL_TRIO_N 25..73 CDD:215024 11/52 (21%)
CRAL_TRIO 99..248 CDD:279044 43/153 (28%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000269|PubMed:23599266, ECO:0007744|PDB:3W67 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000269|PubMed:23599266, ECO:0007744|PDB:3W68 208..211 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.