DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and sec14l5

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_031749906.1 Gene:sec14l5 / 493292 XenbaseID:XB-GENE-953433 Length:793 Species:Xenopus tropicalis


Alignment Length:291 Identity:61/291 - (20%)
Similarity:109/291 - (37%) Gaps:72/291 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PELAKKAHDELGEIP-DRIDED----------------IETLRTWISKQPHLKARQDAQFLVAFL 61
            |.....|..||...| |::|.|                :..||.|:.:....|..:| :.::.||
 Frog   221 PSSPTAATHELSSTPDDKLDADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKD-EHILRFL 284

  Fly    62 RGCKYSLEKTKLKLDNFYAMRGAVPELYKNRIVGEKQ------LSILDTGCLLRLPQPL------ 114
            |...::::|.:              |:....:...||      ||..|.      ||.|      
 Frog   285 RARDFNIDKAR--------------EILCQSLTWRKQHHVDYLLSTWDP------PQVLHDYYAG 329

  Fly   115 -----QADGPRIHISRYGQYDSK--------KYSIAEVVQVNTMLGEIQIREDDNAM---ISGFV 163
                 ..||..:::.|.||.|:|        :..:..|:.:|.. |..:..|:.|..   ||.:.
 Frog   330 GWHHHDRDGRPLYVLRLGQMDTKGLVRALGEESLLRHVLSINEE-GLRRCEENTNIFGRPISSWT 393

  Fly   164 EIIDMKGVGAGHLFQFDAVLVKKLAVLGDKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRK 228
            .::|::|:...||::.....:.::..:.:..||........:.||.......::....:.|..||
 Frog   394 CLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDENTRK 458

  Fly   229 RFHIHSKLD-----SLYKYVPKECLPAEYGG 254
            :|.|::..|     .|..|:.||.:|...||
 Frog   459 KFLIYAGNDYQGPGGLIDYIDKEVIPDFLGG 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 11/60 (18%)
SEC14 117..254 CDD:238099 33/152 (22%)
sec14l5XP_031749906.1 PRELI 17..173 CDD:398400
CRAL_TRIO_N 256..301 CDD:215024 10/59 (17%)
CRAL_TRIO 326..490 CDD:395525 35/165 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.