DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and CG2663

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster


Alignment Length:304 Identity:111/304 - (36%)
Similarity:172/304 - (56%) Gaps:5/304 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SPELAKKAHDEL--GEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKTKLKL 75
            :|:......:||  .|.|..|:.||:.:|.|:..||||....|...|..||||||:||||.|.||
  Fly     7 TPDQRVSIREELREPEDPADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRGCKFSLEKVKKKL 71

  Fly    76 DNFYAMRGAVPELYKNRIVGEKQLSI-LDTGCLLRLPQPLQADGPRIHISRYGQYDSKKYSIAEV 139
            |.:|.||.||||.:.||.:..::|:| ||......|| .:..:|.||...|....|.:.:.|.:.
  Fly    72 DMYYTMRNAVPEFFSNRDINREELNIVLDYVHCPTLP-GITPNGRRITFIRGIDCDFQPHHILDA 135

  Fly   140 VQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDKAYPYRPKGFHF 204
            ::|..|:|::::.| ::..|:|.:.|:|.....|.|..:|...:|||..:...:|||.:.|..|.
  Fly   136 MKVALMIGDVRLAE-ESVGIAGDIFILDASVASAAHFAKFSPTVVKKFLIAVQEAYPVKVKEVHV 199

  Fly   205 VNAPSSAEKFMSIAKSLMSEKIRKRFHIHSKLDSLYKYVPKECLPAEYGGSNGTIQDVVSTWRTK 269
            :|.....:...:..|..:.||||.|...|:.::||||.||::.||.||||..|.:.::...|:.|
  Fly   200 INISPLVDTIFNFVKPFVKEKIRSRITFHNDVESLYKVVPRDLLPNEYGGKAGGVVELNQWWKQK 264

  Fly   270 LLAYKPFFEEEASYGTNEKLRRGQPVSAESLFGIEGSFRKLDID 313
            |:....:|:::.....||.||.|.|.:::.|||:||:||:|:||
  Fly   265 LVDNTQWFKDQEDKKANESLRPGAPKTSDDLFGMEGTFRQLNID 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 23/44 (52%)
SEC14 117..254 CDD:238099 43/136 (32%)
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 24/45 (53%)
SEC14 95..250 CDD:238099 50/156 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
55.020

Return to query results.
Submit another query.