DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and rlbp1b

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_991253.1 Gene:rlbp1b / 402990 ZFINID:ZDB-GENE-040426-1870 Length:307 Species:Danio rerio


Alignment Length:260 Identity:62/260 - (23%)
Similarity:113/260 - (43%) Gaps:37/260 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KKAHDELGEIPDRIDEDIETLRTWISKQPH-----LKARQDA------QFLVAFLRGCKYSLEKT 71
            :||.|||.|..::....::.||..|.::..     .|..||.      ..||.|:|..||.:.:.
Zfish    46 QKAKDELNETDEKRTSAVKELRGIIKEKAETGDELAKGVQDTFGEKPDGVLVRFIRARKYDVNRA 110

  Fly    72 KLKLDNFYAMRGAVPELYKNRIVGEKQLSILDTGCLLRLPQPLQADGPRIHISR--YGQ------ 128
            ...:..:...|...|||::| :..|...|.::.|.            |.|..||  ||:      
Zfish   111 YELMKGYVRFRRDYPELFEN-LTPEAVRSTIEAGY------------PGILSSRDKYGRVVLLFN 162

  Fly   129 ---YDSKKYSIAEVVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVL 190
               :|.::.:..|:::...::.| ::.|::...|:||..|.:.||.............:||:..:
Zfish   163 IENWDYEEITFDEILRAYCVILE-KLLENEETQINGFCIIENFKGFTMQQASGIKPTELKKMVDM 226

  Fly   191 GDKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHIH-SKLDSLYKYVPKECLPAEYGG 254
            ...::|.|.|..||::.|.......::.|.||..|:.:|..:| ..|::.:|....|.||:::.|
Zfish   227 LQDSFPARFKAVHFIHQPWYFTTTYNVVKPLMKSKLLERVFVHGDDLENYFKEFDAEILPSDFDG 291

  Fly   255  254
            Zfish   292  291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 12/55 (22%)
SEC14 117..254 CDD:238099 35/148 (24%)
rlbp1bNP_991253.1 CRAL_TRIO_N 60..117 CDD:215024 12/56 (21%)
CRAL_TRIO 143..292 CDD:279044 37/162 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579396
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.