DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and rlbp1a

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_956999.1 Gene:rlbp1a / 393678 ZFINID:ZDB-GENE-040426-1662 Length:312 Species:Danio rerio


Alignment Length:250 Identity:57/250 - (22%)
Similarity:109/250 - (43%) Gaps:15/250 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KKAHDELGEIPDRIDEDIETLRTWISKQPH-----LKARQDA------QFLVAFLRGCKYSLEKT 71
            :||.|||.|..::....|:.||..|..:..     .|..||.      ..|:.|:|..|:.:.:.
Zfish    45 QKAKDELNETDEKRASAIKELRAMIKDKAGQGDEVAKTVQDKFGKEPDSLLLRFIRARKFDVARA 109

  Fly    72 KLKLDNFYAMRGAVPELYKNRIVGEKQLSILDTGCLLRLPQPLQADGPRIHISRYGQYDSKKYSI 136
            ...:..:...|...|||::| :..|...|.::.| ..|:......:|..:.:.....:|.::.:.
Zfish   110 HELMKGYVRFRRDYPELFEN-LTPEAVRSTIEAG-YPRILSTRDKNGRVVLLFNIDNWDLEEVTF 172

  Fly   137 AEVVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDKAYPYRPKG 201
            .|.::...::.| ::.|::...|:|||.|.:.||....|........:||:..:...::|.|.|.
Zfish   173 DETLRAYCVILE-KLLENEETQINGFVLIENFKGFTMQHASGIKHTELKKMVDMLQDSFPARFKA 236

  Fly   202 FHFVNAPSSAEKFMSIAKSLMSEKIRKRFHIH-SKLDSLYKYVPKECLPAEYGGS 255
            .|.::.|.......::.|..|..|:.:|..:| .:||...:....|.||.::.|:
Zfish   237 VHVIHQPWYFTTTYNVVKPFMKSKLLERVFVHGDELDGYLRDFGAEILPPDFDGT 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 11/55 (20%)
SEC14 117..254 CDD:238099 30/137 (22%)
rlbp1aNP_956999.1 CRAL_TRIO_N 59..116 CDD:215024 11/56 (20%)
CRAL_TRIO 142..291 CDD:279044 32/150 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579395
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.