DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and CG32407

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster


Alignment Length:251 Identity:51/251 - (20%)
Similarity:99/251 - (39%) Gaps:47/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PDRIDEDIETLRTWISKQP--------HLKARQDAQ-FLVAFLRGCKYSLEKTKLKLDNFYAMRG 83
            |::|.:...::...:.|:|        .||...|:. ::...|:...:.:||...:|.:..|.|.
  Fly     9 PEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDNLAWRK 73

  Fly    84 A-----VPELYKNRIVGEKQLSILDTGCLL-----RLPQPLQADGPRIHISRYGQYDSKKYSI-- 136
            :     :.|...|:       ..|:.|.:.     |..:||.....:.|.....|.|..:..:  
  Fly    74 SFGVYDITEANLNQ-------EFLNDGSIYVHNKDRDGKPLLILTIKKHSKSRNQEDLLRILVFW 131

  Fly   137 AEVVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDKAYPYRPKG 201
            .|.:|.::.|.:|.|             .:||.|.|..:|   |...:|.:..:.:..|||.|..
  Fly   132 IERLQRDSNLDKITI-------------FMDMTGAGLSNL---DMGFIKSIIGVFETKYPYVPNY 180

  Fly   202 FHFVNAPSSAEKFMSIAKSLMSEKIRKRFHIHSKLDSLYKYVPKE-CLPAEYGGSN 256
            ....:.|...:....:.|:.:..:..|...:.:|.| :.:||.|: ||.. :||::
  Fly   181 ILVHDLPFLLDAAFKLVKTFLPPEALKILKVTTKKD-IDQYVDKDNCLKI-WGGND 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 9/53 (17%)
SEC14 117..254 CDD:238099 29/139 (21%)
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 34/158 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.