DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and Cralbp

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster


Alignment Length:333 Identity:92/333 - (27%)
Similarity:147/333 - (44%) Gaps:53/333 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PE-LAKKAHDELGEIPDRI--DEDIETLRTWISKQPHLK-ARQDAQFLVAFLRGCKYSL---EKT 71
            || |.|.|..||.|  ||.  ::.:|.||.|::|...|: .|.|..||:.|||..|:|:   |:|
  Fly    12 PEALLKIAKRELRE--DRCTREQSLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKKFSVPMAEQT 74

  Fly    72 KLKLDNFYAMRGAVPELYKNRIVGEKQL-SILDTGCLLRLPQ---------PLQADG--PRIHIS 124
            .||..|   :|...|.:.......|.:| .::|.|.:..:||         .:.|.|  |:||.|
  Fly    75 LLKYLN---IRRTFPHMSTQLDYLEPRLGDLIDQGYIFAVPQRDKHGRRVVVINAKGLNPKIHTS 136

  Fly   125 RYGQYDSKKYSIAEVVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAV 189
                .|..|   |..:....::      ||....|:|...:.|..||...|:..::.....::..
  Fly   137 ----CDQAK---AHFLTYECLM------EDQETQITGLTHVGDFAGVTTAHVTNWNPTEFARIFK 188

  Fly   190 LGDKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHIHSKLDSLYKYVPKECLPAEYGG 254
            .|:::.|.|.|..|.:|.||:.:..:...|:.:|.|::.|..|:.....|.|.|.:.|||.|.||
  Fly   189 WGEQSLPMRHKEIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIYGSEKELMKSVDQGCLPLEMGG 253

  Fly   255 SNGTIQDVVSTWRTKLLAYKPF--------------FEEEASYGTNEKLRRGQPVSAESLFGIEG 305
             ...:::::..|:.:|...:..              .:..:|:... |...|.|.....:..|||
  Fly   254 -KVPMREMIELWKQELATKRDLILGLDKSILRSDRGIQRRSSFNAG-KASTGGPNFVSQIESIEG 316

  Fly   306 SFRKLDID 313
            |||||:.|
  Fly   317 SFRKLEFD 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 19/48 (40%)
SEC14 117..254 CDD:238099 36/138 (26%)
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 18/46 (39%)
SEC14 101..254 CDD:238099 43/166 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
65.920

Return to query results.
Submit another query.