DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and Clvs2

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001101929.1 Gene:Clvs2 / 361459 RGDID:1306801 Length:236 Species:Rattus norvegicus


Alignment Length:238 Identity:54/238 - (22%)
Similarity:94/238 - (39%) Gaps:63/238 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSPELAKKAHDELGEIPDRIDEDIETLRTWISKQPHLK-ARQDAQFLVAFLRGCKYSLEKTKLKL 75
            ||||..:||..||.|.||.:.:||:.:|..:..:|.:. .|.|..|::.|||..|:...:....|
  Rat     8 LSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLL 72

  Fly    76 DNFYAMRGAVPELYKNRIVGEKQLSILDTGCLLRLPQPLQ--ADGPRIHISRYGQ---------Y 129
            ..::..|....:::|:       ....|.|    :.|.|:  ..|...::..||:         :
  Rat    73 AQYFEYRQQNLDMFKS-------FKATDPG----IKQALKDGFPGGLANLDHYGRKILVLFAANW 126

  Fly   130 DSKKYSIAEVVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAV-----LVKKLAV 189
            |..:|::.::::...:..|..| ||....::|||.|||...      |.|...     .:.:||:
  Rat   127 DQSRYTLVDILRAILLSLEAMI-EDPELQVNGFVLIIDWSN------FTFKQASKLTPSMLRLAI 184

  Fly   190 LGDKAYPY----------------------------RPKGFHF 204
            .|.:...|                            :|||:.|
  Rat   185 EGLQVRVYHCYCFFVSYMLFALYVRILDNLWTNKTSKPKGYRF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 12/45 (27%)
SEC14 117..254 CDD:238099 25/130 (19%)
Clvs2NP_001101929.1 CRAL_TRIO_N 29..75 CDD:215024 12/45 (27%)
SEC14 103..>204 CDD:301714 21/107 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.