DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and CG1902

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster


Alignment Length:313 Identity:116/313 - (37%)
Similarity:177/313 - (56%) Gaps:12/313 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IRSLSPELAKKAHDELGEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKTKL 73
            ||||.||||:.|..:|.|.|......||.|||||.||.:|:||.|.||||||||.|::.:|:.|.
  Fly     4 IRSLEPELAEVARTQLCEDPSSTVAKIEALRTWIDKQIYLEARTDDQFLVAFLRFCRWDVEEAKK 68

  Fly    74 KLDNFYAMRGAVPELYKNRIVGEKQLSILDTGCLLRLPQPLQADGPRIHISRYGQYDSKKYSIAE 138
            ::..:|..:....||.|.|.|.:|.:.:..:|....||:|:...|||||.:|.|..:..|:|:::
  Fly    69 RVLFYYTYKSKERELLKGRQVDDKLIELARSGIFATLPKPIGPGGPRIHYTRMGHIEPSKHSVSD 133

  Fly   139 VVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDKAYPYRPKGFH 203
            :.:.:....||:|..|||..|:|.|||||...:....|.|||..:.|::....:...|......|
  Fly   134 IFRFHAFRAEIEINTDDNWNIAGVVEIIDFTKIPYSLLLQFDPGMFKRMNAFLEHGIPANLVATH 198

  Fly   204 FVNAPSSAEKFMSIAKSLMSEKIRKRFHIHSKLDSLYKYVPKECLPAEYGGSNGTIQDVVSTWRT 268
            .|||....:..:.:.:::|.:|  :..||||.:.||.|.:..|.||.|.||.||::.|.::.:.|
  Fly   199 IVNASRETQFVLGLVRNVMKQK--ELLHIHSTVASLRKAIGLEYLPVEMGGDNGSLSDAMTRYET 261

  Fly   269 KLLAYKPFFEEEASYGTNEKLR--------RGQPVSAESLFGIEGSFRKLDID 313
            :||::.|:|.|:..||.:||||        ||.|:..:  ...:|:||.::.|
  Fly   262 QLLSFSPYFTEDERYGVDEKLREASEKDQERGAPLVTD--VPNDGTFRMINFD 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 24/44 (55%)
SEC14 117..254 CDD:238099 45/136 (33%)
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 24/40 (60%)
CRAL_TRIO 100..248 CDD:279044 50/149 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464532
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 1 1.000 - - FOG0006716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
76.850

Return to query results.
Submit another query.