DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and CG10237

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_609967.1 Gene:CG10237 / 35222 FlyBaseID:FBgn0032783 Length:324 Species:Drosophila melanogaster


Alignment Length:277 Identity:76/277 - (27%)
Similarity:125/277 - (45%) Gaps:9/277 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELAKKAHDELGEIPDRIDEDIETLRTWISKQPH-LKARQDAQFLVAFLRGCKYSLEKTKLKLDNF 78
            |:|.|   ||.|.|:|..|..:.|...:..:.. |..:.:.::|:.:||.|||..|..:..:..:
  Fly    54 EVAIK---ELRETPERQKEASKELARLLEAETDLLYPKGNEEWLIRYLRPCKYYPESARDLIKRY 115

  Fly    79 YAMRGAVPELYKNRIVGEKQLSILDTGCLLRLPQPLQADGPRIHISRYG-QYDSKKYSIAEVVQV 142
            ||.:....::|.: :....:.:|.....|...|...|. |.||.:...| ::..|:.::.||.:.
  Fly   116 YAFKVKHADVYTD-LKPSNEANIFKHNILTVFPNRDQL-GRRILVLELGKRWKHKQVTLDEVFKG 178

  Fly   143 NTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDKAYPYRPKGFHFVNA 207
            ..:..|..:.|.: ..|.|.|.|.||.|:.....:||.....|::......:.|.|.|..|.||.
  Fly   179 AVLFLEAAMLEPE-TQICGAVVIFDMDGLSLQQTWQFTPPFAKRIVDWLQDSVPLRIKAIHIVNQ 242

  Fly   208 PSSAEKFMSIAKSLMSEKIRKRFHIH-SKLDSLYKYVPKECLPAEYGGSNGTIQDVVSTWRTKLL 271
            |...:...::.|..:.||:|.|...| :..:||:||:..:||||.|||.....:.....|...||
  Fly   243 PKIFQVVFALFKPFLKEKLRSRIIFHGTDRESLHKYMSPKCLPAAYGGFREASRIDSDQWYQLLL 307

  Fly   272 AYKPFFEEEASYGTNEK 288
            .....|:...|||..:|
  Fly   308 KCDTEFDTINSYGYKKK 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 10/45 (22%)
SEC14 117..254 CDD:238099 41/138 (30%)
CG10237NP_609967.1 CRAL_TRIO_N 68..115 CDD:215024 10/46 (22%)
SEC14 137..290 CDD:238099 45/154 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447129
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
76.850

Return to query results.
Submit another query.