DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and Ku80

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster


Alignment Length:296 Identity:53/296 - (17%)
Similarity:101/296 - (34%) Gaps:95/296 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LKARQDAQFLVAFLRGCKYSLEKTKLKLDNFYAMRGAVPELYKNRIVGEKQ--LSILDTGCLLRL 110
            :.:.::...:|..:|.|  :.|:.|||      ....|.|:.|::||.:::  :|.:..||    
  Fly     1 MASNKECLIIVLDVRTC--AAEEVKLK------SAKCVAEILKDKIVCDRKDYVSFVLVGC---- 53

  Fly   111 PQPLQADGPRIHISRYGQYDSKKYSIAEVVQVNTM-LGEIQIRE----------------DDNAM 158
                               |:.:....:....|.: .||.::..                :|...
  Fly    54 -------------------DTDEIKTEDASHPNVLPFGEPRLCSWQLLLEFFQFVNKTACEDGEW 99

  Fly   159 ISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMS 223
            ::|....::::.|....     .|..:::.:|           |.|.:.|...|||..|...|:.
  Fly   100 LNGLQAALELQNVATTL-----RVARRRILLL-----------FDFNDFPQDYEKFNEITDELLG 148

  Fly   224 EKIRKRFHIH----------SKLDSLYKYVPKECLPAEYGGSNGTIQDVVSTWRTKLLAYKPFFE 278
            |.|......|          |:..:::.: .::|.|.|.......: .:|......|.::|    
  Fly   149 ENIELIVGTHNIAYIDNAITSQPQAIFNF-SRKCGPDELNNQKYAL-SLVPRCNATLCSFK---- 207

  Fly   279 EEASYGT-----------NEKLRRGQPVSAESLFGI 303
             ||.:..           |.||..|..:|. ||.||
  Fly   208 -EALHTVFKVTNRRPWVWNAKLNIGSKISI-SLQGI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 7/28 (25%)
SEC14 117..254 CDD:238099 24/163 (15%)
Ku80NP_609767.2 Ku_N 7..213 CDD:281693 44/259 (17%)
KU80 221..524 CDD:238445 9/22 (41%)
Ku_PK_bind 562..663 CDD:285938
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.