DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and CG5973

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster


Alignment Length:301 Identity:91/301 - (30%)
Similarity:136/301 - (45%) Gaps:42/301 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SPELA-KKAHDELGEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKTKLKLD 76
            :||.| |||.|||.|:|...::.|:.||..|..:.:|....|.::::.|||...|..|....:|.
  Fly    31 APEWALKKAQDELREVPGVKEQAIKELRELIQNEKYLNLPLDDEYMMMFLRPTHYYPESALKRLK 95

  Fly    77 NFYAMR---GAVPELYKNRIVGEKQLSILDTGCLLRLPQPLQADGPRIHISRYGQYDSKKYSIAE 138
            |||.|:   ||..|    .|:..|..::.:...|..|||..| .|.|:.:...|    ||:..::
  Fly    96 NFYHMKLKYGAACE----NIIPSKLRNVFEANILNLLPQRDQ-HGRRLLVLEAG----KKWKPSQ 151

  Fly   139 VVQVN-------TMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDKAYP 196
            |..|:       |:||.:   .:..:.|.|.|.||||:|:...|:.||.......|.....:...
  Fly   152 VPLVDLFRGIQLTVLGSM---VEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECIC 213

  Fly   197 YRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHIHSK-LDSLYKYVPKECLPAEYGGSNGTIQ 260
            .|.|..|.||.........::.|..:.||:|||...|.| ..||..::..:.||.:||||     
  Fly   214 MRLKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAKALPPKYGGS----- 273

  Fly   261 DVVSTWRT---KLL-----AYKPFFEEEASYGTNE--KLRR 291
               :||..   |:|     .|...:|...|||..|  |:::
  Fly   274 ---ATWELPHGKVLGEFFECYSKDYELADSYGYTEGYKMKK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 12/44 (27%)
SEC14 117..254 CDD:238099 40/144 (28%)
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 12/44 (27%)
SEC14 116..272 CDD:238099 45/163 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
65.920

Return to query results.
Submit another query.