DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and retm

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster


Alignment Length:270 Identity:59/270 - (21%)
Similarity:105/270 - (38%) Gaps:45/270 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SNSIRSLSPELAKKAHDELGEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEK 70
            :.|:..|||....|.. ||.::.|.:| |:|.:.::.:....|.|| |.....|:...|.....:
  Fly   211 ARSLGQLSPMQESKLL-ELRKMLDGVD-DLERVPSYQTILRFLAAR-DWHVSQAYAMLCDSLRWR 272

  Fly    71 TKLKLDNFYAMRGAVPELYKNRIVGEKQLSILDTGCLLRLP---QPLQADGPRIHISRYGQYDSK 132
            .:.::|...|      |..|..:|.|            ..|   ..|..||..::|.|.|..|.|
  Fly   273 REHRIDALLA------EYSKPAVVVE------------HFPGGWHHLDKDGRPVYILRLGHMDVK 319

  Fly   133 KYSIAEVVQVNTMLG-EIQIREDDNAMISGFVE-----------IIDMKGVGAGHLFQFDAVLVK 185
              .:.:.:.::.:|. .:.|.|:....|:...|           ::|::|:...||::.....:.
  Fly   320 --GLLKSLGMDGLLRLALHICEEGIQKINESAERLEKPVLNWSLLVDLEGLSMRHLWRPGIKALL 382

  Fly   186 KLAVLGDKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHI------HSKLDSLYKYVP 244
            .:....::.||........|.||.......:|..:.:.|..|.:|..      |.| |.|.:|:.
  Fly   383 NIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMK-DGLAQYLD 446

  Fly   245 KECLPAEYGG 254
            :|.:|...||
  Fly   447 EEIVPDFLGG 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 9/44 (20%)
SEC14 117..254 CDD:238099 32/154 (21%)
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 13/48 (27%)
CRAL_TRIO 293..456 CDD:279044 34/165 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.