DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and ttpa

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_956025.2 Gene:ttpa / 325906 ZFINID:ZDB-GENE-030131-4631 Length:285 Species:Danio rerio


Alignment Length:267 Identity:68/267 - (25%)
Similarity:122/267 - (45%) Gaps:34/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SNSIRSLSPELAKKAHDELGEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEK 70
            |:.|.....||.:||..||     || .|::..:|               ||:.||:...:.:..
Zfish    19 SSRIAPYLSELKEKAEAEL-----RI-RDLDLSKT---------------FLIRFLQARDFDVAL 62

  Fly    71 TKLKLDNFYAMRGAVPE----LYKNRIVGEKQLSILDTGCLLRLPQPLQADGPRIHISRYGQYDS 131
            ....|.|::..|...||    |..:.::|..|.:.  .|.|    :.....|.|:.|.|.|:::.
Zfish    63 ALKLLINYHKWRQECPEITADLRPSSVIGLLQNNY--HGVL----RSRDDAGSRVLIYRIGKWNP 121

  Fly   132 KKYSIAEVVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDKAYP 196
            |:::..||.:|:.:..|:.::|.:... :|...|.|::.....|..|.:..|.||::.:...::|
Zfish   122 KEFTAYEVFRVSLITSELIVQEWETQR-NGLKAIFDLQDWCFAHALQINPSLAKKISSVLTDSFP 185

  Fly   197 YRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHIH--SKLDSLYKYVPKECLPAEYGGSNGTI 259
            .:.:|.|.:|.|.......::.:..:.:||::|.|:|  |...||..|.||..||..|||:..::
Zfish   186 LKVRGIHLINEPIFFRPVFAMIRPFLPDKIKQRIHMHGCSYARSLCNYFPKAVLPPVYGGTGPSV 250

  Fly   260 QDVVSTW 266
            .:|...|
Zfish   251 DEVCQEW 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 7/44 (16%)
SEC14 117..254 CDD:238099 38/138 (28%)
ttpaNP_956025.2 CRAL_TRIO_N 26..70 CDD:215024 15/64 (23%)
CRAL_TRIO 97..246 CDD:279044 41/155 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.