DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and CG31636

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster


Alignment Length:315 Identity:134/315 - (42%)
Similarity:195/315 - (61%) Gaps:11/315 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NSIRSLSPELAKKAHDELGEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKT 71
            :|:|.|:..|.:....||.|:|.|:.:|||.||.|:.|||||:|..|.|||:|||||.|:|||:.
  Fly     2 SSVRPLNAALQEICIRELNELPARMAQDIEALRDWVLKQPHLRACTDDQFLLAFLRGTKFSLERA 66

  Fly    72 KLKLDNFYAMRGAVPELY-KNRIVGEKQ-LSILDTGCLLRLPQPLQADGPRIHISRYGQYDSKKY 134
            |.|.|.||.::.::||:: :.|:..:.| |.|:..|.||::|......|||:.|.|.|.||:.|:
  Fly    67 KEKFDRFYTLQRSIPEVFNERRLATDPQVLDIVRMGVLLQIPMDADDPGPRVTIIRAGSYDTSKH 131

  Fly   135 SIAEVVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDKAYPYRP 199
            ...::::|.:|.|||.:.|||||.:||:|||:||.||...|||.....|:.|.:...|:|.|.|.
  Fly   132 KFQDIIRVGSMFGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFALQPQLLSKFSTYADEAMPTRQ 196

  Fly   200 KGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHIHSKLDSLYKYVPKECLPAEYGGSNGTIQDVVS 264
            ||.||:|.|::.|...:..:|....||:.|..:.|...::|:.|.::.||.||||:.|.:||:..
  Fly   197 KGIHFINVPAAFETGFNSLRSFFPAKIKSRISVSSDPAAIYELVRRKYLPQEYGGTGGNLQDISH 261

  Fly   265 TWRTKLLAYKPFFEEEASYGTNEKLR------RGQPVSAESLFGIEGSFRKLDID 313
            |...||.:|.|:|.|..::|.|:|||      ||   :..|.||..||||||:||
  Fly   262 TMEAKLSSYGPYFRESQNFGANDKLREFGDHKRG---NHRSSFGAVGSFRKLEID 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 27/44 (61%)
SEC14 117..254 CDD:238099 55/136 (40%)
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 27/44 (61%)
SEC14 96..252 CDD:238099 62/155 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464511
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 1 1.000 - - FOG0006716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
65.940

Return to query results.
Submit another query.