DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and SEC14L4

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_016884276.1 Gene:SEC14L4 / 284904 HGNCID:20627 Length:465 Species:Homo sapiens


Alignment Length:277 Identity:57/277 - (20%)
Similarity:110/277 - (39%) Gaps:72/277 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SIRSLSPELAKKAHDELGEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKT- 71
            :|||.|.:..:...|.|..:|:                      .|..||:.:||...:.|:|: 
Human    70 TIRSSSAQFRENLQDLLPILPN----------------------ADDYFLLRWLRARNFDLQKSE 112

  Fly    72 -----------KLKLDNFYAMRGAVPELYKNRIVGEKQLSILDTGCLLRLPQPLQADGPRIHISR 125
                       :..|||....:  .||:          :.:.|:|.|.    ....:|..::.:.
Human   113 DMLRRHMEFRKQQDLDNIVTWQ--PPEV----------IQLYDSGGLC----GYDYEGCPVYFNI 161

  Fly   126 YGQYD--------SKKYSIAEVVQV-NTMLGEIQI------REDDNAMISGFVEIIDMKGVGAGH 175
            .|..|        ||:..|.:.::| ..:|.|.::      |:.:.|::     :.||:|:...|
Human   162 IGSLDPKGLLLSASKQDMIRKRIKVCELLLHECELQTQKLGRKIEMALM-----VFDMEGLSLKH 221

  Fly   176 LFQFDAVLVKKLAVLGDKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHI--HSKLDS 238
            |::....:.::...:.:..||...|....:.||.......::.||.|||:.|::..|  .:....
Human   222 LWKPAVEVYQQFFSILEANYPETLKNLIVIRAPKLFPVAFNLVKSFMSEETRRKIVILGDNWKQE 286

  Fly   239 LYKYVPKECLPAEYGGS 255
            |.|::..:.||.|:||:
Human   287 LTKFISPDQLPVEFGGT 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 8/56 (14%)
SEC14 117..254 CDD:238099 33/153 (22%)
SEC14L4XP_016884276.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.