DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and SEC14L3

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_011528430.1 Gene:SEC14L3 / 266629 HGNCID:18655 Length:412 Species:Homo sapiens


Alignment Length:272 Identity:54/272 - (19%)
Similarity:104/272 - (38%) Gaps:51/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SNSIRSLSPELAKKAHDELGEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEK 70
            |..:..|||:.|    :.|.:..:.:.:.:..|           ...|..||:.:||...:.|:|
Human     2 SGRVGDLSPKQA----ETLAKFRENVQDVLPAL-----------PNPDDYFLLRWLRARNFDLQK 51

  Fly    71 TKLKLDNFYAMRGAV----------PELYKNRIVGEKQLSILDTGCLLRLPQPLQADGPRIHISR 125
            ::..|..:...|..:          ||:.:..:.|..        |      ....||..:....
Human    52 SEALLRKYMEFRKTMDIDHILDWQPPEVIQKYMPGGL--------C------GYDRDGCPVWYDI 102

  Fly   126 YGQYDSK--KYSIAEVVQVNTMLGEIQ--IREDD------NAMISGFVEIIDMKGVGAGHLFQFD 180
            .|..|.|  .:|:.:...:.|.:.:.:  :.|.|      ...|...|.|.|.:|:|..|.::..
Human   103 IGPLDPKGLLFSVTKQDLLKTKMRDCERILHECDLQTERLGKKIETIVMIFDCEGLGLKHFWKPL 167

  Fly   181 AVLVKKLAVLGDKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHI--HSKLDSLYKYV 243
            ..:.::...|.::.||...|....|.|........::.|..:||..|::..:  ::..:.|.|.:
Human   168 VEVYQEFFGLLEENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIIVLGNNWKEGLLKLI 232

  Fly   244 PKECLPAEYGGS 255
            ..|.|||::||:
Human   233 SPEELPAQFGGT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 9/44 (20%)
SEC14 117..254 CDD:238099 32/148 (22%)
SEC14L3XP_011528430.1 CRAL_TRIO_N 13..59 CDD:215024 11/60 (18%)
SEC14 76..245 CDD:214706 38/183 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.