DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and Ttpa

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_037180.1 Gene:Ttpa / 25571 RGDID:3915 Length:278 Species:Rattus norvegicus


Alignment Length:260 Identity:71/260 - (27%)
Similarity:122/260 - (46%) Gaps:38/260 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELAKKAHDELGEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKTKLKLDNFY 79
            ||.::|.:|  .:|:             :.||...|     ||:.|||...:.|:.....:.|:|
  Rat    30 ELRRRAQEE--GVPE-------------TPQPLTDA-----FLLRFLRARDFDLDLAWRLMKNYY 74

  Fly    80 AMRGAVPE----LYKNRIVGEKQLSILDTGC--LLRLPQPLQADGPRIHISRYGQYDSKKYSIAE 138
            ..|...||    |:...|:|     :|..|.  :||...|   .|.|:.|.|...:|.|.::..:
  Rat    75 KWRAECPELSADLHPRSILG-----LLKAGYHGVLRSRDP---TGSRVLIYRISYWDPKVFTAYD 131

  Fly   139 VVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDKAYPYRPKGFH 203
            |.:|:.:..|:.::|.:... :|...|.|::|....|.||....:.||:|.:...::|.:.:|.|
  Rat   132 VFRVSLITSELIVQEVETQR-NGVKAIFDLEGWQISHAFQITPSVAKKIAAVVTDSFPLKVRGIH 195

  Fly   204 FVNAPSSAEKFMSIAKSLMSEKIRKRFHIHSK--LDSLYKYVPKECLPAEYGGSNGTIQDVVSTW 266
            .:|.|.......|:.|..::|||:.|.|:|..  ..||.::.| :.||.||||:..:::|:...|
  Rat   196 LINEPVIFHAVFSMIKPFLTEKIKGRIHLHGNNYKSSLLQHFP-DILPLEYGGNESSMEDICQEW 259

  Fly   267  266
              Rat   260  259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 9/44 (20%)
SEC14 117..254 CDD:238099 40/138 (29%)
TtpaNP_037180.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
CRAL_TRIO_N 25..73 CDD:215024 14/62 (23%)
CRAL_TRIO 99..248 CDD:395525 45/153 (29%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 208..211 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.