DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and CG30339

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster


Alignment Length:306 Identity:143/306 - (46%)
Similarity:215/306 - (70%) Gaps:0/306 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SIRSLSPELAKKAHDELGEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKTK 72
            ::|.||.||.:.|..||.|:.:|:..|::.||.|::|||||:||||.||||.||||||:||||||
  Fly     3 NLRPLSAELRRIAETELNEVEERVPADLKALRDWLAKQPHLRARQDDQFLVGFLRGCKFSLEKTK 67

  Fly    73 LKLDNFYAMRGAVPELYKNRIVGEKQLSILDTGCLLRLPQPLQADGPRIHISRYGQYDSKKYSIA 137
            .|||:||.::..:|||:..|:|.|:.|.:..:|..:|||:|...||||:.::.|.::|.|::.:.
  Fly    68 SKLDHFYTIKTLMPELFGKRLVDERNLILCRSGTYVRLPKPWGTDGPRLQLTNYEKFDPKEFKLL 132

  Fly   138 EVVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDKAYPYRPKGF 202
            ::.:..||:.|..|||||::.|||:|||:||..:....|.|.|..|:|::.:..:||.|.|.||.
  Fly   133 DLFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIFAEKAQPTRLKGV 197

  Fly   203 HFVNAPSSAEKFMSIAKSLMSEKIRKRFHIHSKLDSLYKYVPKECLPAEYGGSNGTIQDVVSTWR 267
            |.:|.|......:::|||||..|:::|||::..|:.|.:.:|:|.||.||||:||.|.|:.:...
  Fly   198 HLINCPKEGVALLNLAKSLMPSKLQQRFHVYKNLEQLNEVIPREYLPEEYGGNNGRIADIQAEAE 262

  Fly   268 TKLLAYKPFFEEEASYGTNEKLRRGQPVSAESLFGIEGSFRKLDID 313
            .|||:|:.:|.|::.||.:|:||.|:.|:|:|:||.||||||||||
  Fly   263 KKLLSYESYFAEDSQYGVDEQLRPGKRVNADSIFGAEGSFRKLDID 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 31/44 (70%)
SEC14 117..254 CDD:238099 54/136 (40%)
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 29/41 (71%)
CRAL_TRIO 109..250 CDD:279044 55/140 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464506
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 1 1.000 - - H119972
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 1 1.000 - - FOG0006716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
87.850

Return to query results.
Submit another query.