DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and Clvs2

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_780657.1 Gene:Clvs2 / 215890 MGIID:2443223 Length:327 Species:Mus musculus


Alignment Length:318 Identity:80/318 - (25%)
Similarity:143/318 - (44%) Gaps:56/318 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSPELAKKAHDELGEIPDRIDEDIETLRTWISKQPHLK-ARQDAQFLVAFLRGCKYSLEKTKLKL 75
            ||||..:||..||.|.||.:.:||:.:|..:..:|.:. .|.|..|::.|||..|:...:....|
Mouse     8 LSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLL 72

  Fly    76 DNFYAMRGAVPELYKNRIVGEKQLSILDTGCLLRLPQPLQ--ADGPRIHISRYGQ---------Y 129
            ..::..|....:::|:       ....|.|    :.|.|:  ..|...::..||:         :
Mouse    73 AQYFEYRQQNLDMFKS-------FKATDPG----IKQALKDGFPGGLANLDHYGRKILVLFAANW 126

  Fly   130 DSKKYSIAEVVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAVL-----VKKLAV 189
            |..:|::.::::...:..|..| ||....::|||.|||...      |.|....     :.:||:
Mouse   127 DQSRYTLVDILRAILLSLEAMI-EDPELQVNGFVLIIDWSN------FTFKQASKLTPNMLRLAI 184

  Fly   190 LG-DKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHIH-SKLDSLYKYVPKECLPAEY 252
            .| ..::|.|..|.||||.|.......::.:..:.||.|||..:| :.|:||::.:..|.||:|:
Mouse   185 EGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEF 249

  Fly   253 GGSNGTIQDVVSTWRTKLLAYKPFFEEEASYGTN---------------EKLRRGQPV 295
            ||......  :.||...||.::  :::::.|..:               :.::|.|.|
Mouse   250 GGMLPPYD--MGTWARTLLDHE--YDDDSEYNVDSYNMPVKDVDKELSPKSMKRSQSV 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 12/45 (27%)
SEC14 117..254 CDD:238099 41/152 (27%)
Clvs2NP_780657.1 CRAL_TRIO_N 29..75 CDD:215024 12/45 (27%)
SEC14 106..251 CDD:238099 41/151 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..327 3/15 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835978
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.