DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and R03A10.5

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_510554.2 Gene:R03A10.5 / 181634 WormBaseID:WBGene00010985 Length:382 Species:Caenorhabditis elegans


Alignment Length:161 Identity:37/161 - (22%)
Similarity:64/161 - (39%) Gaps:25/161 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 DGPRIHISRYGQYD----SKKYSIAEV-----VQVNTMLGEIQIREDDNAMISGFVEIIDMKGVG 172
            |...::|.:.|:.|    .:.|||.||     |.:..||..:...|......:..:.::|:.|: 
 Worm    96 DNVIVNIEQCGKTDYTGMMETYSILEVMRARMVDLEQMLHHVMELEAKTGKQAWILYVMDITGL- 159

  Fly   173 AGHLFQFDAVL-------VKKLAVLGDKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRF 230
                 |::..|       :|.||......|....|.|..|..||.|.....:.:.|:.||.|::.
 Worm   160 -----QYNKKLYDLVTGSMKSLADFMADHYVEMIKYFVPVCVPSFATALYVVVRPLLPEKTREKV 219

  Fly   231 HIHSKL---DSLYKYVPKECLPAEYGGSNGT 258
            .:..:.   |.:.:|.....||:.:...|.|
 Worm   220 RLIGETNWRDDVLQYAIHSSLPSIWNNENHT 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024
SEC14 117..254 CDD:238099 35/155 (23%)
R03A10.5NP_510554.2 SEC14 77..249 CDD:214706 35/158 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.