DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and CLVS1

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_775790.1 Gene:CLVS1 / 157807 HGNCID:23139 Length:354 Species:Homo sapiens


Alignment Length:302 Identity:81/302 - (26%)
Similarity:129/302 - (42%) Gaps:63/302 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSPELAKKAHDELGEIPDRIDEDIETLRTWISKQPHLK-ARQDAQFLVAFLRGCKYSLEKTKLKL 75
            ||||..:||..||.|.||.:.:||:.:|..|..:|.:. .|.|..|::.|||..|:........|
Human    30 LSPETIEKARLELNENPDVLHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFRLL 94

  Fly    76 DNFYAMRGAVPELYKNRIVGEKQLSILDTGCLLRLPQPLQADGPRI-------------HISRYG 127
            ..::..|....:::||                      .:||.|.|             :...||
Human    95 AQYFQYRQLNLDMFKN----------------------FKADDPGIKRALIDGFPGVLENRDHYG 137

  Fly   128 Q---------YDSKKYSIAEVVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAV- 182
            :         :|..:.|..::::...:..|:.| ||....|:||:.|||...      |.|... 
Human   138 RKILLLFAANWDQSRNSFTDILRAILLSLEVLI-EDPELQINGFILIIDWSN------FSFKQAS 195

  Fly   183 ----LVKKLAVLG-DKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHIH-SKLDSLYK 241
                .:.|||:.| ..::|.|..|.||||.|.......::.|..:.:|.|||..:| :.|:||::
Human   196 KLTPSILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQ 260

  Fly   242 YVPKECLPAEYGGSNGTIQDVVSTWRTKLLAYKPFFEEEASY 283
            .:..|.||:|:||:.....  :.||...||.  |.:.:|..|
Human   261 LIHPEFLPSEFGGTLPPYD--MGTWARTLLG--PDYSDENDY 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 13/45 (29%)
SEC14 117..254 CDD:238099 44/165 (27%)
CLVS1NP_775790.1 CRAL_TRIO_N 51..97 CDD:215024 13/45 (29%)
CRAL_TRIO 125..274 CDD:306996 42/155 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145888
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.